RVPGGKRTKELGLVVPIPEEDGLTDGQIAALFVVALVVLIAAVDLARSLYFGLQPNKFKTAKGKGSITPFMKRLIENGF
The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8jjr:m | 79 | 79 | 1.0000 | 1.0000 | 1.0000 | 4.29e-52 | |
2 | 8jze:m | 79 | 79 | 0.6962 | 0.6962 | 0.6962 | 5.71e-38 | 8jzf:m |
3 | 8jw0:m | 89 | 78 | 0.4304 | 0.3820 | 0.4359 | 2.60e-18 | |
4 | 8wm6:M | 30 | 28 | 0.1519 | 0.4000 | 0.4286 | 2.2 | 8wmj:M, 8wmv:M, 8wmw:M, 7y7b:M, 7y8a:M |
5 | 2imr:A | 380 | 35 | 0.1899 | 0.0395 | 0.4286 | 6.3 | |
6 | 8d8j:d | 660 | 39 | 0.1772 | 0.0212 | 0.3590 | 6.3 | 8d8k:d |
7 | 6rxt:UD | 772 | 52 | 0.2278 | 0.0233 | 0.3462 | 8.5 | 6rxu:UD, 6rxv:UD, 6rxx:UD, 6rxy:UD, 6rxz:UD |
8 | 7z36:B | 446 | 19 | 0.1139 | 0.0202 | 0.4737 | 9.1 | 6h3a:A, 6h3a:F, 6qaj:A, 6qaj:B, 6qu1:A, 2yvr:A, 2yvr:B, 7z36:A |
9 | 6iih:A | 446 | 19 | 0.1139 | 0.0202 | 0.4737 | 9.1 | 6iih:B, 6lb7:B, 6xqo:J |
10 | 7cmh:B | 458 | 41 | 0.1772 | 0.0306 | 0.3415 | 9.6 | 7b00:A, 7cmi:B |