RTFLHAVDVVLDPDTAHPDLFLSEDRRSVRRCPFRHLGESVPDNPERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVG
VCRDSVERKGEVLLIPQNGFWTLEMHKGQYRAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFS
VPVRPFFRLGCEDSPIFICPALTGANGVTVPEEGLTLHR
The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8igt:A | 208 | 198 | 0.9950 | 0.9519 | 1.0000 | 2.24e-147 | 8jyc:A, 8jyc:B, 8jye:A, 8jye:B |
2 | 8hjt:A | 197 | 198 | 0.7940 | 0.8020 | 0.7980 | 5.31e-116 | 8hjt:B |
3 | 8jya:B | 191 | 183 | 0.4774 | 0.4974 | 0.5191 | 2.67e-59 | 8hjt:C, 8hjt:D, 8jy9:A, 8jy9:B, 8jyf:B |
4 | 6j0k:A | 191 | 177 | 0.4623 | 0.4817 | 0.5198 | 6.40e-56 | 6j0g:A, 6j0g:B, 6j0g:C, 6j0g:D, 6j0k:B |
5 | 8ixv:A | 187 | 183 | 0.4573 | 0.4866 | 0.4973 | 2.90e-55 | 8ize:A, 8izg:A, 6j06:A, 6j06:C, 6j06:B, 8jyc:C, 8jyc:D, 8jye:C, 8jye:D, 4n7u:A, 5zxk:A |
6 | 8pd6:A | 181 | 176 | 0.4422 | 0.4862 | 0.5000 | 7.01e-53 | |
7 | 4cg4:C | 376 | 189 | 0.4372 | 0.2314 | 0.4603 | 1.99e-50 | 4cg4:D, 4cg4:E, 4cg4:F |
8 | 7ovx:A | 174 | 176 | 0.3769 | 0.4310 | 0.4261 | 6.66e-40 | 8a5l:A, 8a5m:A, 8a5m:B, 8a8x:A, 8a8x:C, 7ow2:A, 7ow2:B, 7ow2:C, 7ow2:D, 8r5b:A, 8r5b:B, 8r5c:A, 7w0q:A, 7w0s:B, 7w0s:C, 7w0s:E, 7w0t:F, 7w0t:B, 7w0t:C, 7x6y:A, 7x6z:A, 7x70:A |
9 | 7xt2:B | 388 | 174 | 0.2613 | 0.1340 | 0.2989 | 5.01e-18 | 7xt2:A |
10 | 4b3n:A | 557 | 144 | 0.2462 | 0.0880 | 0.3403 | 3.84e-16 | 4b3n:B |
11 | 7xyz:B | 456 | 147 | 0.2111 | 0.0921 | 0.2857 | 2.33e-15 | 7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D |
12 | 7vyx:A | 1211 | 53 | 0.0854 | 0.0140 | 0.3208 | 3.4 | 7vyx:B |
13 | 4z7k:A | 218 | 78 | 0.0905 | 0.0826 | 0.2308 | 6.6 | 4z7l:A, 4z7l:D, 4z7l:G |
14 | 7z6f:E | 581 | 52 | 0.0905 | 0.0310 | 0.3462 | 7.3 | 7atr:A, 8fsq:A, 8fsr:A, 8fss:A |
15 | 4hea:3 | 756 | 50 | 0.0804 | 0.0212 | 0.3200 | 8.2 | 2fug:3, 2fug:C, 2fug:L, 2fug:U, 4hea:D, 6i0d:3, 6i0d:D, 6i1p:3, 6i1p:D, 3i9v:3, 3i9v:C, 3iam:3, 3iam:C, 3ias:3, 3ias:C, 3ias:L, 3ias:U, 3m9s:3, 3m9s:C, 6q8o:3, 6q8o:D, 6q8w:3, 6q8w:D, 6q8x:3, 6q8x:D, 6y11:3, 6y11:D, 2ybb:3, 6ziy:3, 6zjl:3, 6zjn:3, 6zjy:3 |
16 | 5ub4:B | 279 | 65 | 0.0905 | 0.0645 | 0.2769 | 8.6 | 5ub4:A, 5ub6:A, 5ub6:B, 5ub7:A, 5ub7:B |
17 | 6xyw:Ay | 111 | 55 | 0.0804 | 0.1441 | 0.2909 | 9.0 | |
18 | 2ihs:A | 203 | 154 | 0.2010 | 0.1970 | 0.2597 | 9.7 | 2ihs:B |