RSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPPNSFRLEKILVSVG
CTCVTPIVH
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5vb9:A | 108 | 90 | 0.9663 | 0.7963 | 0.9556 | 1.45e-59 | 7ama:A, 7ama:B, 7amg:A, 7amg:B, 7amg:C, 7amg:D, 8cdg:A, 8cdg:B, 8dyf:A, 8dyf:B, 8dyg:A, 8dyg:B, 8dyh:A, 8dyh:B, 8dyi:A, 8dyi:B, 5hhv:A, 5hhx:A, 5hi3:A, 5hi3:B, 5hi4:A, 5hi4:B, 5hi5:A, 5hi5:B, 8usr:A, 8usr:B, 8usr:D, 5vb9:B |
2 | 8uss:A | 107 | 89 | 0.9551 | 0.7944 | 0.9551 | 3.86e-58 | |
3 | 3jvf:B | 104 | 88 | 0.5955 | 0.5096 | 0.6023 | 9.64e-32 | |
4 | 8opp:A | 670 | 42 | 0.1461 | 0.0194 | 0.3095 | 0.38 | |
5 | 8opt:A | 783 | 42 | 0.1461 | 0.0166 | 0.3095 | 0.40 | 8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B |
6 | 6z1p:AR | 274 | 55 | 0.1910 | 0.0620 | 0.3091 | 1.3 | |
7 | 6ahr:B | 774 | 44 | 0.1685 | 0.0194 | 0.3409 | 1.4 | 6ahu:B |
8 | 8htu:H | 95 | 18 | 0.0899 | 0.0842 | 0.4444 | 2.3 | 7ksq:H, 7kux:H, 6l35:H, 7xqp:H |
9 | 7wld:K | 331 | 52 | 0.1573 | 0.0423 | 0.2692 | 3.4 | 8imx:K, 8imy:K, 7w72:K |
10 | 8jjm:A | 484 | 43 | 0.1573 | 0.0289 | 0.3256 | 5.4 | 8jjm:B |
11 | 4pu5:A | 438 | 20 | 0.1011 | 0.0205 | 0.4500 | 7.1 | |
12 | 6wb7:A | 296 | 52 | 0.1685 | 0.0507 | 0.2885 | 7.8 | 6wb7:B, 6wb7:C, 6wb7:D |
13 | 1ygp:A | 858 | 18 | 0.0899 | 0.0093 | 0.4444 | 9.4 | 1ygp:B |