RRKKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLS
RLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLPPWFPPMVEGA
The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7u1t:A | 176 | 156 | 0.9750 | 0.8864 | 1.0000 | 4.41e-115 | 1b3t:A, 1b3t:B, 8dlf:A, 8dlf:B, 8dlf:C, 8dlf:D, 6npi:B, 6npm:B, 6npp:B, 6pw2:A, 6pw2:B, 6pw2:C, 6pw2:D, 6pw2:I, 6pw2:J, 6pw2:K, 6pw2:L, 5t7x:A, 5t7x:B, 7u1t:B, 7u1t:C, 7u1t:D, 6vh6:B |
2 | 8fnv:A | 770 | 23 | 0.0688 | 0.0143 | 0.4783 | 0.42 | 8fnv:B, 8fnv:C, 8fnv:D, 8fnv:E, 8fnv:F, 8fnv:G, 8fnv:H, 8fnv:I, 8fnv:J, 8fnv:K, 8fnv:L, 8fnw:A, 8fnw:B, 8fnw:C, 8fnw:D, 8fnw:E, 8fnw:F, 8fnw:G, 8fnw:H, 8fnw:I, 8fnw:J, 8fnw:K, 8fnw:L |
3 | 7exf:B | 719 | 93 | 0.1437 | 0.0320 | 0.2473 | 1.4 | 7exf:A, 7exg:B, 7exg:A, 7exh:B, 7exh:A, 7exj:A, 7exj:B, 7exq:A, 7exq:B, 7exr:A, 7exr:B |
4 | 6ncz:C | 589 | 26 | 0.0875 | 0.0238 | 0.5385 | 2.2 | 6ncz:A, 6ncz:B, 6ncz:D, 6ncz:E, 6ncz:F |
5 | 8bao:A | 368 | 95 | 0.1437 | 0.0625 | 0.2421 | 7.3 | 8bao:B |
6 | 1ibj:A | 380 | 62 | 0.1125 | 0.0474 | 0.2903 | 8.8 | 1ibj:C |