RPLVIILMGSSSDMGHAEKIASELKTFGIEYAIRIGSAHKTAEHVVSMLKEYEALDRPKLYITIAGRSNALSGFVDGFVK
GATIACPPPSDSFAGADIYSSLRMPSGISPALVLEPKNAALLAARIFSLYDKEIADSVKSYMESNAQKIIEDDSKL
The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rgg:A | 156 | 156 | 1.0000 | 1.0000 | 1.0000 | 6.85e-112 | 3rgg:B, 3rgg:C, 3rgg:D |
2 | 7ale:A | 419 | 153 | 0.3462 | 0.1289 | 0.3529 | 2.48e-30 | 7ale:B, 6yb8:A, 6yb8:B, 6yb9:A, 6yb9:B |
3 | 5cli:A | 160 | 151 | 0.3205 | 0.3125 | 0.3311 | 3.10e-04 | 5clj:A, 2fwi:A, 2fwj:A, 2fwp:A, 4z7j:A, 4z7j:B |
4 | 2nsh:A | 163 | 155 | 0.2372 | 0.2270 | 0.2387 | 0.002 | 2ate:A, 1d7a:A, 1d7a:B, 1d7a:C, 1d7a:D, 2nsj:A, 2nsl:A |
5 | 3tm2:A | 367 | 95 | 0.1346 | 0.0572 | 0.2211 | 0.80 | 3tm2:B |
6 | 3q2t:A | 205 | 87 | 0.1667 | 0.1268 | 0.2989 | 6.4 | 3bho:A, 3mdg:A, 3mdi:A, 3p6y:A, 3p6y:B, 3p6y:E, 3p6y:I, 3p6y:M, 3p6y:N, 3p6y:F, 3q2t:B, 5r4p:A, 5r4p:B, 5r4q:A, 5r4q:B, 5r4r:A, 5r4r:B, 5r4s:A, 5r4s:B, 5r4t:A, 5r4t:B, 5r4u:A, 5r4u:B, 5r64:A, 5r64:B, 5r65:A, 5r65:B, 5r66:A, 5r66:B, 5r67:A, 5r67:B |
7 | 3odm:C | 530 | 40 | 0.0833 | 0.0245 | 0.3250 | 9.2 | 3odm:A, 3odm:D, 3odm:E, 3odm:H |