RPLVFLCSGCRRPLGDSLSWVANCILLRCVSCNVSVDGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIES
YVLG
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7sfz:H | 84 | 84 | 1.0000 | 1.0000 | 1.0000 | 1.56e-55 | |
2 | 7sfz:A | 100 | 98 | 1.0000 | 0.8400 | 0.8571 | 6.44e-51 | 7sfz:B, 7sfz:C, 7sfz:D, 7sfz:E, 7sfz:F, 7sfz:G |
3 | 5j6p:B | 102 | 99 | 0.4048 | 0.3333 | 0.3434 | 1.03e-09 | 5hj0:A, 5hj0:B, 5hj0:C, 5j6p:A, 5j6p:C |
4 | 1wyh:A | 72 | 28 | 0.1786 | 0.2083 | 0.5357 | 0.37 | |
5 | 5jio:A | 467 | 58 | 0.2262 | 0.0407 | 0.3276 | 2.5 | 5k41:A, 5k42:A, 5k44:A, 5k5c:A, 5l3k:A, 5l3k:B, 5l3k:C, 5l3k:D, 5l3k:E, 5l3k:F, 5l3k:G, 5l3k:H |
6 | 3adp:A | 310 | 17 | 0.0952 | 0.0258 | 0.4706 | 3.7 | |
7 | 7r81:L2 | 90 | 24 | 0.1190 | 0.1111 | 0.4167 | 5.8 | 7olc:SK, 7old:SK, 8oo0:SK, 7z3n:SK, 7z3o:SK |