BioLiP

>protein
RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVGGGCRAKRNNFKSAEDCMRTCGGA

The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4bnr:J	58	58	0.9828	0.9828	0.9828	2.42e-37	1bhc:J, 4bnr:I, 1bpi:A, 1bz5:A, 2fi3:I, 2fi4:I, 2fi5:I, 3fp7:J, 2ftl:I, 2ftm:B, 3ldj:B, 3ldj:C, 6pti:A, 1qlq:A
2	4bqd:A	78	52	0.3621	0.2692	0.4038	2.36e-09	4bqd:B
3	5nx1:D	42	41	0.3103	0.4286	0.4390	9.17e-07	5nx3:D
4	2knt:A	58	53	0.2931	0.2931	0.3208	4.10e-06	1knt:A
5	5jbt:Y	38	36	0.2586	0.3947	0.4167	1.79e-05
6	8zsz:A	315	14	0.1379	0.0254	0.5714	1.5	8zsb:A, 8zsb:B, 8zsz:B
7	7mbp:A	996	21	0.2069	0.0120	0.5714	1.5	7mbp:B, 7mbp:C, 7mbp:D, 7mbq:A, 7mbq:B, 7mbq:C, 7mbq:D, 7mbr:A, 7mbr:B, 7mbr:C, 7mbr:D, 7mbs:A, 7mbs:B, 7mbs:C, 7mbs:D, 7mbt:A, 7mbt:D, 7mbt:B, 7mbt:C, 7mbu:A, 7mbu:D, 7mbu:B, 7mbu:C, 7mbv:A, 7mbv:B, 7mbv:C, 7mbv:D
8	8btd:SC	210	42	0.2931	0.0810	0.4048	4.5	8br8:SC, 8brm:SC, 8bsi:SC, 8bsj:SC, 8btr:SC, 8fvy:D, 8g4s:D, 7pwf:D, 7pwo:D1
9	8ova:AX	208	32	0.2241	0.0625	0.4062	5.3	7ase:M, 5opt:m, 8ove:AX, 4v8m:AX
10	5v8k:A	600	21	0.1552	0.0150	0.4286	5.4
11	2wr8:A	258	24	0.1897	0.0426	0.4583	5.9	1wu8:A, 1wu8:B, 1wu8:C
12	3ux8:A	564	36	0.2069	0.0213	0.3333	6.2
13	8a98:SC	212	32	0.2414	0.0660	0.4375	7.7	8a3w:SC, 6az1:C, 8ovj:SC, 8rxh:SC, 8rxx:SC, 5t2a:AX
14	2pfy:A	301	22	0.1552	0.0299	0.4091	8.1	2pfy:B, 2pfy:C, 2pfy:D

[Back]