RNRPGTKAQDFYNWTLAVQQYIQQNIRADCSNIDKILEPPDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCIFLCAAH
KTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTK
FVMKYNLMSKDNLIVPI
The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7k36:H | 177 | 177 | 1.0000 | 1.0000 | 1.0000 | 2.67e-135 | |
2 | 5yf4:A | 129 | 144 | 0.6780 | 0.9302 | 0.8333 | 2.10e-82 | |
3 | 5brk:A | 194 | 151 | 0.2034 | 0.1856 | 0.2384 | 3.47e-05 | 5b5v:A, 5b5v:C, 5b5v:B, 5b5v:D, 5b5w:A, 5b6b:A, 5b6b:B, 5b6b:D, 5b6b:F, 5b6b:H, 5b6b:K, 5b6b:M, 5b6b:O, 5brm:A, 5brm:B, 5brm:C, 5brm:D, 5brm:E, 5brm:F, 4j1v:A, 4j1v:C, 4jiz:A, 6mcp:B, 6mcp:D, 6mcq:B, 6mcq:D, 1pi1:A, 5twf:A, 5twf:B, 5twg:A, 5twh:A, 5xqz:A, 5xqz:B |
4 | 2hjn:A | 206 | 162 | 0.1977 | 0.1699 | 0.2160 | 1.64e-04 | 5ncn:A |
5 | 5ncm:A | 183 | 118 | 0.1356 | 0.1311 | 0.2034 | 0.18 | |
6 | 8q6o:E | 249 | 47 | 0.0904 | 0.0643 | 0.3404 | 6.8 | 8q6o:6 |
7 | 3re3:B | 144 | 104 | 0.1582 | 0.1944 | 0.2692 | 6.9 | |
8 | 6lpf:B | 1006 | 108 | 0.1412 | 0.0249 | 0.2315 | 8.0 | 6kid:A, 6kie:A, 6kqy:A, 6kr7:A, 6lpf:A, 6lr6:A, 6lr6:B |
9 | 7aor:aa | 1558 | 33 | 0.0621 | 0.0071 | 0.3333 | 8.1 | |
10 | 6o3p:B | 320 | 45 | 0.0904 | 0.0500 | 0.3556 | 8.1 |