RMKQLEDKVEETLSKVYHLENEVARLKKLVG
The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1ysa:C | 57 | 31 | 0.9355 | 0.5088 | 0.9355 | 6.05e-14 | 1dgc:A, 2dgc:A, 1ysa:D |
| 2 | 5apw:B | 64 | 29 | 0.9032 | 0.4375 | 0.9655 | 1.38e-12 | |
| 3 | 5apw:B | 64 | 30 | 0.8710 | 0.4219 | 0.9000 | 2.28e-12 | |
| 4 | 3i5c:B | 198 | 30 | 0.9032 | 0.1414 | 0.9333 | 7.88e-12 | 3i5c:A, 1ij0:A, 1ij0:B, 1ij0:C, 1ij1:A, 1ij1:B, 1ij1:C, 3k7z:A, 3k7z:B, 1rb4:A, 1rb4:B, 1swi:C, 6xne:C |
| 5 | 1uo4:B | 31 | 30 | 0.7097 | 0.7097 | 0.7333 | 1.52e-10 | 1uo5:A |
| 6 | 1llm:C | 87 | 27 | 0.8065 | 0.2874 | 0.9259 | 2.08e-10 | 1llm:D |
| 7 | 1fav:A | 78 | 27 | 0.6129 | 0.2436 | 0.7037 | 2.97e-10 | 6j5e:G, 6tvq:AaA, 6tvu:AaA, 6tvw:CCC, 3vgx:C, 3vu5:A, 3vu6:A, 3w19:C, 5yb4:E, 5yb4:F, 5yb4:D |
| 8 | 3crp:B | 34 | 31 | 0.7742 | 0.7059 | 0.7742 | 3.35e-10 | 2b1f:A, 2b1f:C, 3crp:C |
| 9 | 1uny:B | 30 | 30 | 0.7097 | 0.7333 | 0.7333 | 4.60e-10 | |
| 10 | 2bni:C | 34 | 31 | 0.6774 | 0.6176 | 0.6774 | 1.58e-09 | 2bni:D, 1u9h:A |
| 11 | 1czq:A | 45 | 30 | 0.6129 | 0.4222 | 0.6333 | 3.47e-07 | 1gzl:A, 1gzl:B, 3l35:A, 3l35:C, 3l35:B, 3l36:A, 3l37:A, 3mgn:D, 3mgn:F, 3mgn:A, 3mgn:C, 3mgn:E, 3mgn:B, 6psa:A, 2q3i:A, 2r3c:A, 2r3c:B, 2r5b:A, 2r5b:C, 2r5b:B, 2r5d:A, 2r5d:C, 2r5d:B |
| 12 | 2r2v:C | 33 | 31 | 0.5484 | 0.5152 | 0.5484 | 1.14e-06 | 2r2v:D |
| 13 | 4hjb:C | 30 | 31 | 0.6129 | 0.6333 | 0.6129 | 1.98e-06 | 4hjb:D |
| 14 | 3w8v:A | 32 | 31 | 0.6129 | 0.5938 | 0.6129 | 3.02e-04 | 3w8v:B, 3w92:A, 3w92:B, 3w92:C, 3w93:A, 3w93:B, 3w93:C |
| 15 | 8epv:A | 136 | 16 | 0.2581 | 0.0588 | 0.5000 | 5.3 | |
| 16 | 6iry:A | 468 | 20 | 0.2903 | 0.0192 | 0.4500 | 5.6 | 6irz:A, 6is0:A |
| 17 | 7zw0:sh | 776 | 20 | 0.3226 | 0.0129 | 0.5000 | 6.5 | |
| 18 | 7fqi:A | 265 | 15 | 0.2903 | 0.0340 | 0.6000 | 8.5 | 4aw9:A, 4awa:A, 4awb:A, 4awb:B, 7fqh:A, 7fqh:B, 7fqh:D, 7fqi:C, 7fqi:B, 7fqj:A, 7fqj:C, 7fqj:B, 7fqk:A, 7fqk:B, 7fqk:C, 7fqk:D, 7fql:A, 7fql:F, 7fql:B, 7fql:H, 7fql:C, 7fql:G, 7fql:D, 7fql:E, 5lu8:A, 5lu9:A, 5lua:B, 5lub:B, 7o50:A, 7o50:B |
| 19 | 3hf0:A | 30 | 14 | 0.2903 | 0.3000 | 0.6429 | 9.5 |
zhanggroup.org