BioLiP

>protein
RMKQLEDKVEELLSKAYHLENEVARLKKLV

The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1ysa:C	57	30	0.9667	0.5088	0.9667	1.13e-13	1dgc:A, 2dgc:A, 1ysa:D
2	3i5c:B	198	30	0.9667	0.1465	0.9667	7.76e-13	3i5c:A, 1ij0:A, 1ij0:B, 1ij0:C, 1ij1:A, 1ij1:B, 1ij1:C, 3k7z:A, 3k7z:B, 1rb4:A, 1rb4:B, 1swi:C, 6xne:C
3	5apw:B	64	29	0.9333	0.4375	0.9655	1.36e-12
4	5apw:B	64	29	0.9000	0.4219	0.9310	4.86e-12
5	1llm:C	87	26	0.8333	0.2874	0.9615	2.22e-10	1llm:D
6	3crp:B	34	30	0.8000	0.7059	0.8000	5.54e-10	2b1f:A, 2b1f:C, 3crp:C
7	1uny:B	30	30	0.7333	0.7333	0.7333	6.97e-10
8	1uo4:B	31	29	0.7000	0.6774	0.7241	1.86e-09	1uo5:A
9	2bni:C	34	30	0.6667	0.5882	0.6667	2.16e-09	2bni:D, 1u9h:A
10	1fav:A	78	26	0.6000	0.2308	0.6923	8.12e-09	6j5e:G, 6tvq:AaA, 6tvu:AaA, 6tvw:CCC, 3vgx:C, 3vu5:A, 3vu6:A, 3w19:C, 5yb4:E, 5yb4:F, 5yb4:D
11	1czq:A	45	30	0.6333	0.4222	0.6333	7.96e-08	1gzl:A, 1gzl:B, 3l35:A, 3l35:C, 3l35:B, 3l36:A, 3l37:A, 3mgn:D, 3mgn:F, 3mgn:A, 3mgn:C, 3mgn:E, 3mgn:B, 6psa:A, 2q3i:A, 2r3c:A, 2r3c:B, 2r5b:A, 2r5b:C, 2r5b:B, 2r5d:A, 2r5d:C, 2r5d:B
12	4hjb:C	30	23	0.5333	0.5333	0.6957	7.08e-06	4hjb:D
13	2r2v:C	33	30	0.5333	0.4848	0.5333	5.10e-05	2r2v:D
14	3w8v:A	32	30	0.6000	0.5625	0.6000	0.003	3w8v:B, 3w92:A, 3w92:B, 3w92:C, 3w93:A, 3w93:B, 3w93:C
15	4oo8:A	1301	22	0.3333	0.0077	0.4545	4.6	4zt0:C

[Back]