RLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFS
KFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGIS
VGLYDTTPLLDTNSLEENAMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRVSN
ASA
The query sequence (length=243) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6fsz:BB | 244 | 242 | 0.9959 | 0.9918 | 1.0000 | 3.79e-179 | 4ifd:B, 5jea:B, 5k36:B, 8qcf:C |
2 | 6d6q:B | 241 | 234 | 0.3457 | 0.3485 | 0.3590 | 1.06e-46 | 6d6r:B |
3 | 3m7n:E | 248 | 233 | 0.3251 | 0.3185 | 0.3391 | 4.11e-35 | 3m7n:F, 3m7n:D, 3m85:F, 3m85:D, 3m85:E |
4 | 2wnr:B | 222 | 226 | 0.2881 | 0.3153 | 0.3097 | 2.54e-31 | 2wnr:D, 2wnr:F |
5 | 2pnz:A | 236 | 233 | 0.3169 | 0.3263 | 0.3305 | 9.37e-31 | 2po0:A, 2po1:A, 2po2:A |
6 | 2c39:D | 248 | 227 | 0.2922 | 0.2863 | 0.3128 | 1.24e-25 | 4ba1:B, 4ba2:B, 2c37:B, 2c37:F, 2c37:N, 2c37:V, 2c37:X, 2c38:B, 2c38:F, 2c38:H, 2c38:J, 2c38:N, 2c38:V, 2c38:X, 2c39:B, 2c39:F, 2c39:H, 2c39:J, 2c39:L, 2c39:N, 2c39:P, 2c39:R, 2c39:T, 2c39:V, 2c39:X, 2jea:B |
7 | 1r6m:A | 236 | 187 | 0.2263 | 0.2331 | 0.2941 | 6.21e-12 | |
8 | 6d6q:F | 252 | 148 | 0.1770 | 0.1706 | 0.2905 | 8.43e-09 | 6d6r:F |
9 | 3dd6:A | 244 | 184 | 0.2016 | 0.2008 | 0.2663 | 5.68e-06 | |
10 | 5yjj:A | 442 | 201 | 0.2099 | 0.1154 | 0.2537 | 1.20e-05 | 5yjj:B, 5yjj:C, 5yjj:D, 5yjj:E, 5yjj:F |
11 | 4aim:A | 698 | 201 | 0.2016 | 0.0702 | 0.2438 | 4.11e-05 | 4aid:A, 4aid:B, 4aid:C, 4am3:A, 4am3:C, 4am3:B |
12 | 8wx0:A | 597 | 162 | 0.1605 | 0.0653 | 0.2407 | 0.017 | 8wx0:B, 8wx0:C |
13 | 7ld5:A | 587 | 162 | 0.1481 | 0.0613 | 0.2222 | 0.23 | 7ld5:B, 7ld5:C |
14 | 3gme:A | 482 | 95 | 0.1029 | 0.0519 | 0.2632 | 0.27 | |
15 | 7ogk:A | 695 | 95 | 0.1029 | 0.0360 | 0.2632 | 0.29 | 3gcm:A, 3gcm:B, 3gcm:C, 3h1c:A, 3h1c:B, 3h1c:C, 3h1c:K, 3h1c:G, 3h1c:I, 3h1c:M, 3h1c:O, 3h1c:R, 3h1c:T, 3h1c:V, 3h1c:X, 7ogk:B, 7ogk:C, 7ogm:L, 7ogm:N, 7ogm:O |
16 | 3hwo:A | 379 | 132 | 0.1317 | 0.0844 | 0.2424 | 0.41 | 3hwo:B, 5jxz:A, 5jxz:B, 5jy4:A, 5jy4:B, 5jy8:A, 5jy8:B, 5jzd:A, 5jzd:B |
17 | 6d6q:C | 265 | 256 | 0.2469 | 0.2264 | 0.2344 | 0.97 | 6d6r:C |
18 | 2pnz:B | 267 | 131 | 0.1276 | 0.1161 | 0.2366 | 1.1 | |
19 | 3m85:I | 259 | 126 | 0.1317 | 0.1236 | 0.2540 | 1.2 | 3m7n:I, 3m7n:G, 3m7n:H, 3m85:G, 3m85:H |
20 | 1e3p:A | 645 | 208 | 0.1811 | 0.0682 | 0.2115 | 1.4 | |
21 | 8svp:B | 268 | 40 | 0.0658 | 0.0597 | 0.4000 | 1.8 | 8f5y:B, 2qnv:A, 1skx:A, 5x0r:A, 5x0r:B, 6xp9:A, 6xp9:B |
22 | 6vm6:B | 440 | 15 | 0.0370 | 0.0205 | 0.6000 | 3.4 | 6vm6:A, 6vm6:C, 6vm6:D, 6vm6:E, 6wan:A, 6wan:B, 6wan:C, 6wan:D, 6wan:E |
23 | 6wan:F | 415 | 15 | 0.0370 | 0.0217 | 0.6000 | 3.5 | |
24 | 8jjm:A | 484 | 44 | 0.0576 | 0.0289 | 0.3182 | 6.8 | 8jjm:B |
25 | 8a47:C | 297 | 111 | 0.1111 | 0.0909 | 0.2432 | 7.8 | |
26 | 7wsm:A | 464 | 46 | 0.0700 | 0.0366 | 0.3696 | 9.0 | 7wsn:A |