RLEECNILFELLTEIQDEAGSMEKIVHKTLQRLSQLLAADRCSMFICRSRNGIPEVATRLLNVTPTSKFEDNLVNPDKET
The query sequence (length=171) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3dba:A |
171 |
171 |
1.0000 |
1.0000 |
1.0000 |
2.55e-127 |
3dba:B |
2 |
8ulg:B |
824 |
171 |
0.5263 |
0.1092 |
0.5263 |
3.28e-53 |
7jsn:B, 6mzb:B, 8ufi:B, 8ugb:B, 8ugs:B |
3 |
8ulg:B |
824 |
90 |
0.1228 |
0.0255 |
0.2333 |
1.7 |
7jsn:B, 6mzb:B, 8ufi:B, 8ugb:B, 8ugs:B |
4 |
8ulg:A |
827 |
170 |
0.4561 |
0.0943 |
0.4588 |
8.73e-47 |
7jsn:A, 6mzb:A, 8ufi:A, 8ugb:A, 8ugs:A |
5 |
2zmf:A |
177 |
155 |
0.2982 |
0.2881 |
0.3290 |
1.08e-20 |
2zmf:B |
6 |
2k31:A |
149 |
147 |
0.2632 |
0.3020 |
0.3061 |
4.72e-14 |
|
7 |
4mcw:B |
363 |
77 |
0.1813 |
0.0854 |
0.4026 |
6.49e-12 |
4mcw:A, 4mdz:A, 4mdz:B, 4me4:A, 4me4:B |
8 |
3ibj:A |
661 |
157 |
0.2573 |
0.0666 |
0.2803 |
1.24e-10 |
4c1i:A, 4c1i:B, 4c1i:C, 4c1i:D, 6c7d:A, 6c7d:B, 6c7d:C, 6c7d:D, 6c7e:A, 6c7e:B, 6c7e:C, 6c7e:D, 6c7f:A, 6c7f:B, 6c7f:C, 6c7g:A, 6c7g:B, 6c7g:C, 6c7g:D, 6c7i:A, 6c7i:B, 6c7i:C, 6c7i:D, 6c7j:A, 6c7j:B, 6c7j:C, 6c7j:D, 4d08:A, 4d08:B, 4d08:C, 4d08:D, 4d09:A, 4d09:B, 4d09:C, 4d09:D, 6ezf:A, 4htx:A, 4htx:B, 4htx:C, 4htx:D, 4htz:A, 4htz:B, 4htz:C, 4htz:D, 3itm:A, 3itm:B, 3itm:C, 3itm:D, 3itu:A, 3itu:B, 3itu:C, 3itu:D, 4jib:A, 4jib:B, 4jib:C, 4jib:D, 1mc0:A, 5tz3:A, 5tz3:B, 5tz3:C, 5tz3:D, 5tza:A, 5tza:B, 5tza:C, 5tza:D, 5tzc:A, 5tzc:B, 5tzc:C, 5tzc:D, 5tzh:A, 5tzh:B, 5tzh:C, 5tzh:D, 5tzw:A, 5tzw:B, 5tzw:C, 5tzw:D, 5tzx:A, 5tzx:B, 5tzx:C, 5tzx:D, 5tzz:A, 5tzz:B, 5tzz:C, 5tzz:D, 5u00:A, 5u00:B, 5u00:C, 5u00:D, 5u7d:A, 5u7d:B, 5u7d:C, 5u7i:A, 5u7i:B, 5u7i:C, 5u7i:D, 5u7j:A, 5u7j:B, 5u7j:C, 5u7j:D, 5u7k:A, 5u7k:B, 5u7k:C, 5u7k:D, 5u7l:A, 5u7l:B, 5u7l:C, 5vp0:A, 5vp0:B, 5vp0:C, 5vp1:A, 5vp1:B, 5vp1:C, 5xkm:A, 5xkm:B, 5xkm:C, 5xkm:D, 5xkm:E, 5xkm:F, 1z1l:A, 6znd:A, 6znd:B, 6zqz:A, 6zqz:B, 6zqz:C, 6zqz:D |
9 |
3ibj:A |
661 |
166 |
0.2515 |
0.0651 |
0.2590 |
2.21e-05 |
4c1i:A, 4c1i:B, 4c1i:C, 4c1i:D, 6c7d:A, 6c7d:B, 6c7d:C, 6c7d:D, 6c7e:A, 6c7e:B, 6c7e:C, 6c7e:D, 6c7f:A, 6c7f:B, 6c7f:C, 6c7g:A, 6c7g:B, 6c7g:C, 6c7g:D, 6c7i:A, 6c7i:B, 6c7i:C, 6c7i:D, 6c7j:A, 6c7j:B, 6c7j:C, 6c7j:D, 4d08:A, 4d08:B, 4d08:C, 4d08:D, 4d09:A, 4d09:B, 4d09:C, 4d09:D, 6ezf:A, 4htx:A, 4htx:B, 4htx:C, 4htx:D, 4htz:A, 4htz:B, 4htz:C, 4htz:D, 3itm:A, 3itm:B, 3itm:C, 3itm:D, 3itu:A, 3itu:B, 3itu:C, 3itu:D, 4jib:A, 4jib:B, 4jib:C, 4jib:D, 1mc0:A, 5tz3:A, 5tz3:B, 5tz3:C, 5tz3:D, 5tza:A, 5tza:B, 5tza:C, 5tza:D, 5tzc:A, 5tzc:B, 5tzc:C, 5tzc:D, 5tzh:A, 5tzh:B, 5tzh:C, 5tzh:D, 5tzw:A, 5tzw:B, 5tzw:C, 5tzw:D, 5tzx:A, 5tzx:B, 5tzx:C, 5tzx:D, 5tzz:A, 5tzz:B, 5tzz:C, 5tzz:D, 5u00:A, 5u00:B, 5u00:C, 5u00:D, 5u7d:A, 5u7d:B, 5u7d:C, 5u7i:A, 5u7i:B, 5u7i:C, 5u7i:D, 5u7j:A, 5u7j:B, 5u7j:C, 5u7j:D, 5u7k:A, 5u7k:B, 5u7k:C, 5u7k:D, 5u7l:A, 5u7l:B, 5u7l:C, 5vp0:A, 5vp0:B, 5vp0:C, 5vp1:A, 5vp1:B, 5vp1:C, 5xkm:A, 5xkm:B, 5xkm:C, 5xkm:D, 5xkm:E, 5xkm:F, 1z1l:A, 6znd:A, 6znd:B, 6zqz:A, 6zqz:B, 6zqz:C, 6zqz:D |
10 |
1ykd:A |
383 |
176 |
0.3041 |
0.1358 |
0.2955 |
3.32e-10 |
1ykd:B |
11 |
1ykd:A |
383 |
143 |
0.2164 |
0.0966 |
0.2587 |
2.50e-06 |
1ykd:B |
12 |
5w10:A |
173 |
84 |
0.1696 |
0.1676 |
0.3452 |
4.41e-10 |
5w10:B, 5w10:C, 5w10:D |
13 |
3ibj:B |
643 |
81 |
0.1754 |
0.0467 |
0.3704 |
2.64e-07 |
|
14 |
3ibj:B |
643 |
166 |
0.2515 |
0.0669 |
0.2590 |
1.95e-05 |
|
15 |
3w2z:A |
178 |
133 |
0.1696 |
0.1629 |
0.2180 |
0.040 |
5zoh:A |
16 |
1guz:A |
305 |
76 |
0.1170 |
0.0656 |
0.2632 |
0.56 |
1guz:B, 1guz:C, 1guz:D |
17 |
1on3:E |
520 |
102 |
0.1520 |
0.0500 |
0.2549 |
0.75 |
1on3:A, 1on3:D, 1on3:B, 1on3:C, 1on3:F, 1on9:A, 1on9:B, 1on9:C, 1on9:D, 1on9:E, 1on9:F |
18 |
3mk4:A |
285 |
68 |
0.1170 |
0.0702 |
0.2941 |
1.5 |
|
19 |
7lsd:B |
152 |
46 |
0.0760 |
0.0855 |
0.2826 |
1.7 |
7lsd:A, 7lsd:C, 7lsd:D |
20 |
9bh5:CV |
128 |
36 |
0.0702 |
0.0938 |
0.3333 |
2.9 |
9cai:CV |
21 |
6bhn:A |
156 |
153 |
0.1754 |
0.1923 |
0.1961 |
4.3 |
6bho:A |
22 |
5nws:A |
395 |
63 |
0.1287 |
0.0557 |
0.3492 |
4.4 |
|