BioLiP

>protein
RIPLWLIATVGGTLALTVVGIFFYGSYSGVGSSL

The query sequence (length=34) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8xr6:J	34	34	1.0000	1.0000	1.0000	3.74e-17	8xr6:j
2	4yuu:j2	33	33	0.7059	0.7273	0.7273	1.64e-10	4yuu:J1, 4yuu:j1
3	5b5e:j	40	34	0.6176	0.5250	0.6176	2.77e-10	3a0b:J, 2axt:j, 5b5e:J, 5b66:J, 5b66:j, 7cji:J, 7cji:j, 7cjj:J, 7cjj:j, 7cou:J, 7cou:j, 7d1t:J, 7d1t:j, 7d1u:J, 7d1u:j, 5e79:J, 5e79:j, 5e7c:J, 5e7c:j, 7eda:J, 9evx:j, 8gn0:J, 8gn0:j, 8gn1:J, 8gn1:j, 8gn2:J, 8gn2:j, 5gth:J, 5gth:j, 5gti:J, 5gti:j, 5h2f:J, 5h2f:j, 4il6:J, 4il6:j, 8ir5:J, 8ir5:j, 8ir6:J, 8ir6:j, 8ir7:J, 8ir7:j, 8ir8:J, 8ir8:j, 8ir9:J, 8ir9:j, 8ira:J, 8ira:j, 8irb:J, 8irb:j, 8irc:J, 8irc:j, 8ird:J, 8ird:j, 8ire:J, 8ire:j, 8irf:J, 8irf:j, 8irg:J, 8irg:j, 8irh:J, 8irh:j, 8iri:J, 8iri:j, 6jlj:J, 6jlj:j, 6jlk:J, 6jlk:j, 6jll:j, 6jll:J, 6jlm:J, 6jlm:j, 6jln:J, 6jln:j, 6jlo:J, 6jlo:j, 6jlp:J, 6jlp:j, 3kzi:J, 4pbu:J, 4pbu:j, 7rf4:J, 4rvy:J, 4rvy:j, 4ub6:J, 4ub6:j, 4ub8:J, 4ub8:j, 5v2c:J, 5v2c:j, 4v82:BJ, 6w1q:J, 5ws5:J, 5ws5:j, 5ws6:J, 5ws6:j, 3wu2:J, 3wu2:j, 7yq2:J, 7yq2:j, 7yq7:J, 7yq7:j, 5zzn:J, 5zzn:j
4	6j3y:J	34	34	0.6471	0.6471	0.6471	5.11e-10	6j3y:j, 6j3z:J, 6j3z:j, 6j40:J, 6j40:j, 7vd5:J, 7vd5:j
5	7pin:J	36	34	0.6765	0.6389	0.6765	1.37e-09	7pin:J1, 7piw:J1, 7pnk:J
6	8xqw:C	690	26	0.3824	0.0188	0.5000	0.30
7	4g10:A	263	19	0.2647	0.0342	0.4737	1.8	4yav:A
8	5yjj:A	442	25	0.2941	0.0226	0.4000	4.8	5yjj:B, 5yjj:C, 5yjj:D, 5yjj:E, 5yjj:F

[Back]