BioLiP

>protein
RHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKTAIDKL

The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7vp2:A	83	56	1.0000	0.6747	1.0000	4.10e-36	7vp1:A, 7vp1:B, 7vp2:B, 7vp4:B, 7vp4:A, 7vp4:F, 7vp4:E, 7vp4:J, 7vp4:I, 7vp5:A, 7vp5:B, 7vp5:E, 7vp5:F, 7vp5:I, 7vp5:J, 7vp7:A, 7vp7:B
2	7vp3:C	62	53	0.2857	0.2581	0.3019	6.98e-05	7vp3:D, 7vp3:J, 7vp3:G, 7vp3:L, 7vp3:I, 7vp3:N, 7vp3:P
3	6xpn:B	259	33	0.1786	0.0386	0.3030	0.82	6xpn:A
4	2yck:X	272	49	0.2321	0.0478	0.2653	1.9	2yci:X, 2ycj:A
5	6tz8:B	174	30	0.2500	0.0805	0.4667	2.6	6tz8:E
6	3no5:E	275	17	0.1607	0.0327	0.5294	2.9	3no5:A, 3no5:B, 3no5:C, 3no5:D, 3no5:F
7	2kr2:A	190	39	0.2143	0.0632	0.3077	5.2
8	3puo:A	292	27	0.1786	0.0342	0.3704	6.3	3puo:B, 3s8h:A, 3s8h:B
9	8gy9:A	249	34	0.2321	0.0522	0.3824	6.4	8gy9:B, 8gya:A, 8gya:B, 8gyb:A, 8gyb:B, 8gyb:C, 8gyb:D
10	7wrr:A	650	38	0.2321	0.0200	0.3421	6.4	7wrr:B, 7wrr:C, 7wrr:D, 7wrt:A, 7wrt:B, 7wrt:C, 7wrt:D
11	5hkc:A	114	28	0.1786	0.0877	0.3571	7.0	5hk0:B, 5hk0:D, 5hk3:B
12	7ane:aa	1514	21	0.1786	0.0066	0.4762	7.8
13	9biw:B	528	40	0.1964	0.0208	0.2750	8.6	9biw:A
14	5hht:B	667	38	0.2143	0.0180	0.3158	9.1	5hht:A, 1qgd:A, 1qgd:B, 2r5n:A, 2r5n:B, 2r8o:A, 2r8o:B, 2r8p:A, 2r8p:B, 6rjc:A, 6rjc:B, 6tj8:A, 6tj8:B, 6tj9:A, 6tj9:B, 8wa7:A, 8wa7:B
15	4ylz:C	140	37	0.1964	0.0786	0.2973	9.4	5cbl:A, 5cbl:B, 5cbl:C, 5cbl:D, 6wab:A, 6wab:B, 4ylz:A, 4ylz:B, 4ylz:D, 4ym0:D, 4ym0:A, 4ym0:B, 4ym0:C, 4ym1:A, 4ym1:B, 4ym1:C, 4ym2:A, 4ym2:B, 4ym2:C, 4ym2:D, 4ym3:A, 4ym3:B, 4ym3:C, 4ym3:D

[Back]