RGVNKVILVGNVGGDPETRYMPNGNAVTNITLATSESWQERTEWHRVVFFGRLAEIAGEYLRKGSQVYVEGSLRTRKWQG
QDGQDRYTTEIVVDINGNMQLLG
The query sequence (length=103) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6irq:C | 104 | 106 | 0.9806 | 0.9712 | 0.9528 | 6.69e-67 | 6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D |
2 | 1eqq:B | 120 | 111 | 0.7864 | 0.6750 | 0.7297 | 1.70e-55 | 1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D |
3 | 5odn:D | 106 | 91 | 0.5340 | 0.5189 | 0.6044 | 1.57e-34 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
4 | 5odp:G | 100 | 82 | 0.4563 | 0.4700 | 0.5732 | 8.17e-27 | 5odp:A |
5 | 3ulp:C | 116 | 105 | 0.3883 | 0.3448 | 0.3810 | 3.55e-24 | 3ulp:A, 3ulp:B, 3ulp:D |
6 | 6bhx:C | 102 | 89 | 0.3592 | 0.3627 | 0.4157 | 5.57e-18 | 6bhx:A, 6bhx:B |
7 | 2vw9:A | 108 | 98 | 0.3981 | 0.3796 | 0.4184 | 1.25e-16 | 2vw9:B |
8 | 8gw5:A | 99 | 92 | 0.3301 | 0.3434 | 0.3696 | 3.83e-16 | 7ym1:A |
9 | 6rup:A | 111 | 102 | 0.3592 | 0.3333 | 0.3627 | 4.57e-16 | 6rup:B, 8uzt:A, 8uzt:C, 8uzt:D |
10 | 8uzt:B | 100 | 98 | 0.3689 | 0.3800 | 0.3878 | 2.57e-15 | |
11 | 7dep:B | 102 | 97 | 0.3398 | 0.3431 | 0.3608 | 1.21e-12 | |
12 | 3udg:C | 214 | 95 | 0.3592 | 0.1729 | 0.3895 | 3.88e-11 | 3udg:B, 3udg:A |
13 | 3udg:C | 214 | 77 | 0.2816 | 0.1355 | 0.3766 | 9.67e-09 | 3udg:B, 3udg:A |
14 | 3a5u:A | 118 | 102 | 0.3398 | 0.2966 | 0.3431 | 6.36e-11 | 3a5u:B |
15 | 3vdy:A | 101 | 96 | 0.3010 | 0.3069 | 0.3229 | 2.31e-10 | 3vdy:B |
16 | 5jrc:C | 186 | 51 | 0.1553 | 0.0860 | 0.3137 | 0.18 | 5jrc:A, 5jrc:D, 5jre:D, 5jre:H, 5jre:A, 5jre:B, 5jre:C, 5jre:F, 5jre:E, 5jre:G |
17 | 5oes:E | 448 | 66 | 0.1845 | 0.0424 | 0.2879 | 0.37 | 5oes:A, 5oes:B, 5oes:C, 5oes:D, 5oes:F |
18 | 1uv4:A | 291 | 51 | 0.1553 | 0.0550 | 0.3137 | 2.3 | |
19 | 8c29:R | 219 | 43 | 0.1456 | 0.0685 | 0.3488 | 2.6 | 8c29:r |
20 | 7m2k:A | 169 | 28 | 0.1068 | 0.0651 | 0.3929 | 2.9 | 7m2k:C, 7m2k:E, 7m2k:G, 4mdk:A, 4mdk:B, 4mdk:C, 4mdk:D, 3rz3:A, 3rz3:B, 3rz3:C, 3rz3:D |
21 | 7fh6:A | 653 | 75 | 0.1748 | 0.0276 | 0.2400 | 6.5 | 7fh7:A, 7fh8:A, 7ron:A, 7roo:A |
22 | 3ggl:A | 161 | 51 | 0.1650 | 0.1056 | 0.3333 | 8.1 | 6oe2:A |
23 | 8r5h:C | 203 | 28 | 0.0971 | 0.0493 | 0.3571 | 9.0 | 6nyo:A, 8pql:C, 8q7r:C |
24 | 6sj2:B | 503 | 54 | 0.1650 | 0.0338 | 0.3148 | 9.7 | 6sj0:A, 6sj0:B, 6sj1:A, 6sj1:B, 6sj2:A, 6sj3:A, 6sj3:B, 6sj4:A, 6sj4:B |