RGVNKVILIGNLGDKPELRYTGSGTAVCNMSLATNETYTDSDGNEVQNTEWHDVVAWGRLGEICNEYLKKGSQVYFEGKL
QTRSSTEVKAQEMMFLDSN
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5odp:G | 100 | 99 | 0.9798 | 0.9700 | 0.9798 | 6.34e-68 | 5odp:A |
2 | 5odn:D | 106 | 106 | 0.8586 | 0.8019 | 0.8019 | 1.25e-53 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
3 | 1eqq:B | 120 | 93 | 0.5152 | 0.4250 | 0.5484 | 2.26e-31 | 1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D |
4 | 6irq:C | 104 | 83 | 0.4949 | 0.4712 | 0.5904 | 7.06e-29 | 6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D |
5 | 6bhx:C | 102 | 106 | 0.3939 | 0.3824 | 0.3679 | 2.61e-17 | 6bhx:A, 6bhx:B |
6 | 3ulp:C | 116 | 85 | 0.3232 | 0.2759 | 0.3765 | 7.03e-17 | 3ulp:A, 3ulp:B, 3ulp:D |
7 | 7dep:B | 102 | 102 | 0.3737 | 0.3627 | 0.3627 | 4.36e-15 | |
8 | 2vw9:A | 108 | 77 | 0.3232 | 0.2963 | 0.4156 | 5.15e-15 | 2vw9:B |
9 | 3vdy:A | 101 | 100 | 0.3636 | 0.3564 | 0.3600 | 1.15e-14 | 3vdy:B |
10 | 6rup:A | 111 | 107 | 0.3636 | 0.3243 | 0.3364 | 1.32e-14 | 6rup:B, 8uzt:A, 8uzt:C, 8uzt:D |
11 | 8uzt:B | 100 | 100 | 0.3535 | 0.3500 | 0.3500 | 1.03e-13 | |
12 | 3udg:C | 214 | 89 | 0.3434 | 0.1589 | 0.3820 | 1.01e-11 | 3udg:B, 3udg:A |
13 | 3udg:C | 214 | 105 | 0.3939 | 0.1822 | 0.3714 | 3.82e-08 | 3udg:B, 3udg:A |
14 | 8gw5:A | 99 | 106 | 0.3333 | 0.3333 | 0.3113 | 7.15e-11 | 7ym1:A |
15 | 3a5u:A | 118 | 92 | 0.3333 | 0.2797 | 0.3587 | 2.18e-10 | 3a5u:B |
16 | 1zm8:A | 239 | 64 | 0.1717 | 0.0711 | 0.2656 | 0.67 | |
17 | 5gqo:A | 97 | 50 | 0.1818 | 0.1856 | 0.3600 | 2.4 | |
18 | 6he3:A | 422 | 32 | 0.1515 | 0.0355 | 0.4688 | 3.1 | 6hdz:A, 6hdz:B, 6he1:A, 6he1:B, 6he3:B |
19 | 4rku:G | 84 | 16 | 0.0909 | 0.1071 | 0.5625 | 4.3 | |
20 | 5zji:G | 97 | 16 | 0.0909 | 0.0928 | 0.5625 | 4.6 | |
21 | 4r3a:B | 278 | 29 | 0.1212 | 0.0432 | 0.4138 | 5.6 | |
22 | 8b80:A | 474 | 28 | 0.1111 | 0.0232 | 0.3929 | 5.8 | 8b81:A, 8b81:B, 5okb:B, 5okb:C, 5okb:D, 5oke:C, 5oke:D, 5oke:A, 5oke:B, 5okg:C, 5okg:D, 5okg:A, 5okg:B, 5okk:A, 5okk:B, 5okq:A, 5okq:B, 5okr:A, 5okr:B, 5oks:A, 5oks:B, 4zen:A, 4zen:B, 4zep:A, 4zep:B, 4zfm:D, 4zfm:A, 4zfm:B, 4zfm:C |
23 | 6sl4:A | 150 | 60 | 0.1818 | 0.1200 | 0.3000 | 6.1 | 6sl4:B, 6sl4:C |
24 | 8yik:A | 379 | 47 | 0.1515 | 0.0396 | 0.3191 | 8.0 | |
25 | 5yk6:A | 239 | 64 | 0.1818 | 0.0753 | 0.2812 | 9.4 | 5yk7:C |