RGSHMTEDEIRKLRKLLEEAEKKLYKLEDKTRRSEEISDDPKAQSLQLIAESLMLIAESLLIIAISLLLSS
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tj1:A | 71 | 71 | 1.0000 | 1.0000 | 1.0000 | 9.64e-43 | 6tms:D, 6tms:J |
2 | 5u35:A | 125 | 22 | 0.1690 | 0.0960 | 0.5455 | 0.17 | 5u35:B |
3 | 6xwk:BBB | 172 | 57 | 0.2535 | 0.1047 | 0.3158 | 0.21 | |
4 | 7aia:AAA | 259 | 59 | 0.2817 | 0.0772 | 0.3390 | 0.23 | |
5 | 5mrc:D | 252 | 73 | 0.3239 | 0.0913 | 0.3151 | 0.35 | 3j6b:D, 5mre:D, 5mrf:D |
6 | 3k6j:A | 430 | 46 | 0.2113 | 0.0349 | 0.3261 | 0.38 | |
7 | 2fzn:A | 449 | 51 | 0.2113 | 0.0334 | 0.2941 | 1.0 | |
8 | 7njn:C | 536 | 32 | 0.1831 | 0.0243 | 0.4062 | 1.4 | 6foc:A, 6foc:B, 6foc:C, 8g08:B, 8g08:C, 8g08:A, 8g09:A, 8g09:B, 8g09:C, 8g0a:A, 8g0a:B, 8g0a:C, 8g0c:B, 8g0c:C, 8g0c:A, 8g0d:C, 8g0d:A, 8g0d:B, 8g0e:A, 8g0e:B, 8g0e:C, 7jg5:A, 7jg5:B, 7jg5:C, 7jga:A, 7jga:B, 7jga:C, 7njk:A, 7njk:B, 7njk:C, 7njl:A, 7njl:B, 7njl:C, 7njm:A, 7njm:B, 7njm:C, 7njn:A, 7njn:B, 7njo:A, 7njo:B, 7njo:C, 7njp:A, 7njp:B, 7njp:C, 7njq:A, 7njq:B, 7njq:C, 7njr:A, 7njr:B, 7njr:C, 7njs:A, 7njs:B, 7njs:C, 7nk7:A, 7nk7:B, 7nk7:C, 7nkh:A, 7nkh:B, 7nkh:C, 7nkj:A, 7nkj:B, 7nkj:C, 7y5a:A, 7y5a:B, 7y5a:C, 7y5b:A, 7y5b:B, 7y5b:C, 7y5c:A, 7y5c:B, 7y5c:C |
9 | 5n1q:A | 549 | 23 | 0.1549 | 0.0200 | 0.4783 | 1.4 | 5n1q:D, 5n28:A, 5n28:D, 5n2a:A |
10 | 4x3n:A | 259 | 44 | 0.2113 | 0.0579 | 0.3409 | 1.8 | 4x3n:B, 4x3n:C |
11 | 5m4b:A | 439 | 25 | 0.1549 | 0.0251 | 0.4400 | 4.8 | 5m46:A, 5m49:A, 5m4d:A |
12 | 2c7j:B | 172 | 24 | 0.0986 | 0.0407 | 0.2917 | 5.8 | 2c7k:B, 2c7l:B |
13 | 7cce:A | 159 | 18 | 0.1408 | 0.0629 | 0.5556 | 6.4 | |
14 | 4k9q:A | 531 | 33 | 0.1549 | 0.0207 | 0.3333 | 7.2 | 4k9q:B |
15 | 8swn:A | 1135 | 39 | 0.1690 | 0.0106 | 0.3077 | 7.4 |