BioLiP

>protein
RESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHENVLK

The query sequence (length=48) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1pxe:A	48	48	1.0000	1.0000	1.0000	8.72e-31
2	2mf8:A	75	44	0.5417	0.3467	0.5909	1.88e-13	2jx1:A
3	2mf8:A	75	27	0.4583	0.2933	0.8148	7.33e-11	2jx1:A
4	2jyd:A	46	31	0.4583	0.4783	0.7097	1.03e-11
5	2cs8:A	108	29	0.3750	0.1667	0.6207	2.01e-07
6	2cs8:A	108	31	0.3750	0.1667	0.5806	2.86e-07
7	1e1d:A	553	24	0.2083	0.0181	0.4167	1.3	1e2u:A, 1e9v:A, 1gnt:A, 1oa1:A, 1w9m:A
8	1rp1:A	441	36	0.2917	0.0317	0.3889	1.3
9	6seh:C	252	35	0.2292	0.0437	0.3143	2.6	6seh:A
10	2e7z:A	727	29	0.2083	0.0138	0.3448	3.0
11	8hw0:A	329	17	0.1667	0.0243	0.4706	3.4
12	4hnh:A	219	24	0.2500	0.0548	0.5000	5.0	4hnh:B
13	8adl:B	801	10	0.1458	0.0087	0.7000	5.3	8adl:G, 8adl:O, 8adl:J
14	1lpa:B	449	17	0.1667	0.0178	0.4706	5.6	1lpb:B
15	2yik:A	493	20	0.2083	0.0203	0.5000	5.7
16	1gpl:A	432	17	0.1667	0.0185	0.4706	6.1
17	6sei:A	276	16	0.1458	0.0254	0.4375	8.8	6sei:C
18	8dyu:A	2562	15	0.1667	0.0031	0.5333	9.5	8dyv:A
19	8fcy:A	2864	15	0.1667	0.0028	0.5333	9.5	8fd6:A, 8fdt:A
20	8pqw:A	2892	15	0.1667	0.0028	0.5333	9.5	8pqy:A, 8pqz:A, 8pqz:J
21	5nug:A	2920	15	0.1667	0.0027	0.5333	9.5	5nug:B
22	7z8g:A	3047	15	0.1667	0.0026	0.5333	9.5	8fdu:A, 7z8l:f
23	8ptk:f	4502	15	0.1667	0.0018	0.5333	9.5	8ptk:e
24	7z8f:e	4579	15	0.1667	0.0017	0.5333	9.5	5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A
25	3abi:A	349	14	0.1458	0.0201	0.5000	9.7	3abi:B

[Back]