RAVTLRVLLKDELLEPGEGVLSIYYLGRKFTGDLQLDGRIVWQETGQVFNSPSAWATHCKKLVNPAKKSGWASVKYKGQK
LDKYKAAWLRRH
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ydw:A | 92 | 92 | 1.0000 | 1.0000 | 1.0000 | 8.77e-65 | 7ydw:C |
2 | 7xro:B | 207 | 54 | 0.1739 | 0.0773 | 0.2963 | 0.91 | |
3 | 7kwd:A | 473 | 34 | 0.1196 | 0.0233 | 0.3235 | 1.5 | 7kwd:B |
4 | 8kgf:A | 1261 | 69 | 0.2174 | 0.0159 | 0.2899 | 1.5 | |
5 | 1nj1:A | 463 | 35 | 0.1739 | 0.0346 | 0.4571 | 1.6 | 1nj2:A, 1nj5:A, 1nj6:A |
6 | 8iqi:C | 916 | 43 | 0.1739 | 0.0175 | 0.3721 | 2.7 | 8iqc:A, 8iqc:B, 8iqd:A, 8iqd:B, 8iqd:C, 8iqd:D, 8iqi:A, 8iqi:B, 8iqi:D, 8iqi:E, 8iqi:F |
7 | 5iv8:A | 552 | 47 | 0.1630 | 0.0272 | 0.3191 | 3.4 | 5iv8:C |
8 | 5joj:A | 97 | 20 | 0.1087 | 0.1031 | 0.5000 | 4.6 | |
9 | 1mai:A | 119 | 21 | 0.0978 | 0.0756 | 0.4286 | 7.1 | |
10 | 3sng:A | 267 | 56 | 0.1848 | 0.0637 | 0.3036 | 7.4 | 4dj4:A, 4dj4:B, 4jdg:A |
11 | 6wn6:B | 264 | 50 | 0.1413 | 0.0492 | 0.2600 | 8.1 | 6wn6:A, 6wn6:C, 6wn6:D |