BioLiP

>protein
RARRLVMLRHGQTDYNVGSRMQGQLDTELSELGRTQAVAAAEVLGKRQPLLIVSSDLRRAYDTAVKLGERTGLVVRVDTR
LRETHLGDWQGLTHAQIDADAPGARLAWREDATWAPHGGESRVDVAARSRPLVAELVASEPEWGGADEPDRPVVLVAHGG
LIAALSAALLKLPVANWPALGGMGNASWTQLSGHWAPGSDFESIRWRLDVWNASAQV

The query sequence (length=217) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4pza:B	217	217	1.0000	1.0000	1.0000	2.45e-154	4pza:A, 4qih:A, 4qih:B
2	1h2e:A	207	174	0.2673	0.2802	0.3333	1.56e-17	1h2f:A
3	4ij6:A	207	191	0.2627	0.2754	0.2984	7.34e-16	4ij6:B
4	5zr2:C	198	194	0.2304	0.2525	0.2577	3.25e-10	6m1x:C, 6m1x:D, 5zr2:A, 5zr2:B, 5zr2:D
5	1qhf:A	240	98	0.1567	0.1417	0.3469	1.25e-08	1bq3:D, 1bq3:A, 1bq4:A, 5pgm:E, 1qhf:B
6	5htk:A	425	188	0.2304	0.1176	0.2660	8.84e-06	5hr5:A, 5htk:B
7	1k6m:A	432	185	0.2120	0.1065	0.2486	1.34e-05	1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B
8	1e59:A	239	98	0.1475	0.1339	0.3265	1.75e-05
9	1bif:A	432	188	0.2028	0.1019	0.2340	4.79e-04	2bif:A, 2bif:B
10	2axn:A	451	183	0.1982	0.0953	0.2350	7.33e-04	5ajv:B, 5ajw:A, 5ajx:A, 5ajy:A, 5ajz:A, 5ak0:A, 4d4j:A, 4d4k:A, 4d4l:A, 4d4m:A, 2dwo:A, 2dwp:A, 6etj:A, 6hvh:A, 6hvi:A, 6hvj:A, 2i1v:B, 6ibx:A, 6iby:A, 6ibz:A, 6ic0:A, 4ma4:A, 3qpu:A, 3qpv:A, 3qpw:A
11	3lg2:A	269	107	0.1336	0.1078	0.2710	0.004	3lg2:B, 3lg2:C, 3lg2:D, 3ll4:A, 3ll4:B, 3oi7:A, 3oi7:B, 3oi7:C, 3oi7:D
12	2h4z:A	255	99	0.1382	0.1176	0.3030	0.014	2f90:A, 2f90:B, 2h4z:B, 2hhj:A, 2hhj:B, 7n3r:B, 7n3s:A, 7n3s:B, 7thi:A, 7thi:B
13	4hka:A	345	40	0.0645	0.0406	0.3500	0.42
14	9emu:C	227	85	0.1567	0.1498	0.4000	0.62	9emu:A, 9emu:B, 9emu:D
15	3it5:A	182	68	0.0829	0.0989	0.2647	3.8	3it5:B, 3it5:E, 3it5:G, 3it7:A, 3it7:B

[Back]