QVRTLFVSGLPMDAKPRELYLLFRGARGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDARKMLQGVRFDPEAAQVLRL
ELAKSNTKV
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5tkz:A | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 2.33e-61 | 5tkz:B |
2 | 5det:B | 94 | 89 | 0.6292 | 0.5957 | 0.6292 | 1.88e-35 | 5det:A |
3 | 4qqb:A | 169 | 65 | 0.2697 | 0.1420 | 0.3692 | 1.55e-04 | 1b7f:A, 1b7f:B, 4qqb:B |
4 | 2mb0:B | 95 | 73 | 0.2584 | 0.2421 | 0.3151 | 0.002 | |
5 | 6hpj:B | 84 | 78 | 0.2472 | 0.2619 | 0.2821 | 0.005 | |
6 | 2n7c:A | 89 | 82 | 0.2584 | 0.2584 | 0.2805 | 0.017 | |
7 | 8by6:B | 152 | 69 | 0.2022 | 0.1184 | 0.2609 | 0.053 | 7abg:A1, 6d0y:A, 1h2t:Z, 1h2u:X, 1h2u:Y, 1n52:B, 5oo6:B, 5oo6:E, 5oo6:H, 5oo6:K, 5oo6:N, 5oo6:Q, 5oo6:T, 5oo6:W, 5oob:D, 5oob:J, 5oob:B, 5oob:G, 8pmp:B, 8pnt:B, 8srr:B, 8suy:B |
8 | 4lmz:A | 176 | 83 | 0.2584 | 0.1307 | 0.2771 | 0.063 | 3nmr:A, 3nna:A, 3nnc:A, 3nnh:A, 3nnh:C, 3nnh:B, 3nnh:D |
9 | 4ed5:B | 169 | 74 | 0.2472 | 0.1302 | 0.2973 | 0.098 | 4ed5:A |
10 | 2n82:B | 104 | 69 | 0.2472 | 0.2115 | 0.3188 | 0.27 | 2err:A, 7vrl:B |
11 | 2fy1:A | 108 | 73 | 0.2247 | 0.1852 | 0.2740 | 2.7 | |
12 | 6jvx:A | 87 | 59 | 0.2135 | 0.2184 | 0.3220 | 3.0 | 6jvy:A |
13 | 8v5r:A | 944 | 21 | 0.1011 | 0.0095 | 0.4286 | 3.1 | 8g5i:A, 8g5l:A, 8g5m:A, 8g5n:A, 8g5o:A, 8g5p:A, 8t7e:A |
14 | 8udk:A | 1012 | 21 | 0.1011 | 0.0089 | 0.4286 | 3.2 | 5c51:A, 5c52:A, 5c53:A, 4ztu:A, 4ztz:A |
15 | 8g5j:A | 941 | 21 | 0.1011 | 0.0096 | 0.4286 | 3.2 | |
16 | 8d33:A | 974 | 21 | 0.1011 | 0.0092 | 0.4286 | 3.3 | 8d37:A, 8d3r:A, 8d42:A, 8udl:A, 8v54:A |
17 | 8g5k:A | 905 | 21 | 0.1011 | 0.0099 | 0.4286 | 3.4 | |
18 | 8i0v:4 | 161 | 22 | 0.1124 | 0.0621 | 0.4545 | 3.9 | |
19 | 5o1y:A | 163 | 77 | 0.2247 | 0.1227 | 0.2597 | 4.1 | 5o1z:A, 5o20:A |
20 | 2leb:A | 101 | 36 | 0.1348 | 0.1188 | 0.3333 | 6.8 | 2lec:A |
21 | 1fnx:H | 174 | 64 | 0.2135 | 0.1092 | 0.2969 | 8.6 | 1fxl:A, 1g2e:A |
22 | 6i33:B | 925 | 50 | 0.1798 | 0.0173 | 0.3200 | 9.9 | |
23 | 6i34:B | 954 | 50 | 0.1798 | 0.0168 | 0.3200 | 9.9 | 6i33:A, 6i34:A, 6i34:C, 6i34:D, 6i35:A, 6i35:B, 6i35:C, 6i35:D |