QVIARAASIMRALGSHPHGLSLAAIAQLVGLPRSTVQRIINALEEEFLVEALGPAGGFRLGPALGQLINQAQTDILSLVK
PYLRSLAEELDESVSLASLAGDKIYVLDRIVSERELRVVFPIGINVPAAATAAGKVLLAALPDETLQAALGEQLPVLTSN
TLGRKALVKQLSEVRQSGVASDLDEHIDGVSSFATLLDTYLGYYSLAIVMPSSRASKQSDLIKKALLQSKLNIERAIGR
The query sequence (length=239) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2xro:B | 240 | 239 | 1.0000 | 0.9958 | 1.0000 | 8.82e-170 | 2xro:A, 2xro:E, 2xro:F |
2 | 8eju:B | 257 | 197 | 0.2343 | 0.2179 | 0.2843 | 1.30e-11 | 8eju:A |
3 | 2o99:C | 182 | 147 | 0.1883 | 0.2473 | 0.3061 | 9.52e-11 | 2o99:A, 2o99:B, 2o99:D, 2o9a:A, 2o9a:B, 2o9a:C, 2o9a:D |
4 | 1mkm:A | 246 | 208 | 0.2008 | 0.1951 | 0.2308 | 3.38e-07 | |
5 | 4s13:A | 472 | 180 | 0.1883 | 0.0953 | 0.2500 | 0.002 | 4s13:G |
6 | 1hw5:A | 208 | 43 | 0.0711 | 0.0817 | 0.3953 | 0.031 | 6b6h:G, 6b6h:H, 1cgp:A, 1cgp:B, 2cgp:A, 5ciz:A, 6dt4:A, 6dt4:B, 4ft8:A, 4ft8:B, 3fwe:A, 1g6n:A, 1g6n:B, 2gzw:A, 2gzw:B, 2gzw:C, 2gzw:D, 1hw5:B, 4hzf:A, 4hzf:B, 4i01:A, 4i01:B, 4i02:A, 4i02:B, 4i02:C, 4i02:D, 4i02:E, 4i02:F, 4i09:A, 4i09:B, 4i0a:A, 4i0a:B, 4i0b:A, 4i0b:B, 1i5z:A, 1i5z:B, 1i6x:A, 1i6x:B, 3iyd:G, 3iyd:H, 1j59:A, 1j59:B, 3kcc:A, 3kcc:B, 1lb2:A, 3n4m:A, 4n9i:A, 4n9i:B, 4n9i:C, 4n9i:D, 1o3q:A, 1o3r:A, 1o3s:A, 1o3t:A, 1o3t:B, 6pb4:G, 6pb4:H, 6pb5:G, 6pb5:H, 6pb6:H, 6pb6:G, 3qop:A, 3qop:B, 4r8h:A, 4r8h:B, 3rdi:A, 3rdi:B, 3rou:A, 3rou:B, 3rpq:A, 3rpq:B, 1run:A, 1run:B, 1ruo:A, 1ruo:B, 3ryp:A, 3ryp:B, 3ryr:A, 3ryr:B, 1zrc:A, 1zrc:B, 1zrd:A, 1zrd:B, 1zre:A, 1zre:B, 1zrf:A, 1zrf:B |
7 | 5hpf:A | 175 | 76 | 0.1172 | 0.1600 | 0.3684 | 0.040 | 5hpf:C, 5hpi:A, 5hpi:B, 5hpi:C, 5hpi:D |
8 | 7ff0:A | 206 | 45 | 0.0628 | 0.0728 | 0.3333 | 0.18 | 7few:A, 7few:B, 7ff0:B, 7ff8:A, 7ff8:B, 7ff9:A, 7ff9:B, 7ff9:C, 7ff9:D, 7ff9:E, 7ff9:F, 7ff9:G, 7ff9:H, 2oz6:A |
9 | 5whm:A | 263 | 247 | 0.2301 | 0.2091 | 0.2227 | 0.24 | |
10 | 7bkd:A | 664 | 57 | 0.0753 | 0.0271 | 0.3158 | 1.5 | 7bkb:A, 7bkb:a, 7bkc:A, 7bkc:a, 7bkd:a, 7bke:A, 7bke:a |
11 | 2exu:A | 192 | 27 | 0.0502 | 0.0625 | 0.4444 | 3.0 | |
12 | 7yhq:A | 393 | 40 | 0.0753 | 0.0458 | 0.4500 | 4.3 | |
13 | 7nkx:Z | 156 | 27 | 0.0502 | 0.0769 | 0.4444 | 5.3 | |
14 | 3av8:A | 97 | 67 | 0.0795 | 0.1959 | 0.2836 | 7.6 | 3av8:B, 3av8:C, 3av8:D, 1fxi:A, 1fxi:B, 1fxi:C, 1fxi:D |