BioLiP

>protein
QTIKIGAQSMSESEIIASMQGQLIEHHTDLKTTTIKNLGQQALMNGEIDIAATRYTGDALTGTLRMEPEKDPDKALALTQ
REFKKRYDLKWYDSYGFDNTYAFTVSKELADQYHLETVSDVKKWAPQLKLGVDNYWMKLKGNGYQDFTKTYGMTFGGTYP
MQIGLVYDAVKSGKMDIVLAYSTDGRIKSYGLKMLKDDKQFFPPYDCSPVVPEKVLKEHPELEGIIKKMLGKIDTATMQE
LNYEVDGNLKEPSVVAKEYLEKHRYFE

The query sequence (length=267) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6eyh:A	280	272	0.9925	0.9464	0.9743	0.0	6eyl:A, 6eyl:B, 5nxy:A, 5nxy:C, 3r6u:A
2	3ppo:A	272	271	0.7228	0.7096	0.7122	1.96e-144	3ppo:B, 3ppq:A, 3ppq:B, 3ppr:A, 3ppr:B
3	7s7x:A	278	270	0.3783	0.3633	0.3741	7.16e-59	7s7x:B, 7s7x:C, 6v1r:A
4	7s7t:A	509	192	0.2809	0.1473	0.3906	1.70e-44	8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K
5	7s7t:A	509	102	0.1199	0.0629	0.3137	5.86e-04	8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K
6	7txl:A	275	270	0.3521	0.3418	0.3481	1.93e-44	7txk:A, 7txk:B, 7txl:B
7	8dp7:A	265	263	0.3184	0.3208	0.3232	2.91e-40	8dp7:B, 8dp7:C, 8dp7:D, 8dp7:E
8	1sw1:A	270	270	0.2921	0.2889	0.2889	1.26e-27	1sw1:B, 1sw4:A, 1sw4:B
9	6w2k:A	440	143	0.1461	0.0886	0.2727	1.6	5afa:A, 5g3b:A, 5g3c:A, 5g3d:A, 5g3e:A, 5g3f:A, 5g3g:A, 5g3h:A, 5jrr:A, 5jx9:A, 5k0d:A, 5k15:A, 5k3k:A, 5k5k:A, 5k7a:A, 5k84:A, 6q29:A, 6tyr:A, 6w2k:B, 6w9x:A, 6wcg:A, 6wch:A, 6wcl:A, 6wcm:A, 6wcn:A, 6wcp:A, 2xu9:A, 2yae:A, 2yaf:A, 2yah:A, 2yam:A, 2yao:A, 2yap:A, 2yaq:A, 2yar:A
10	2oje:D	214	75	0.0749	0.0935	0.2667	6.5	2icw:G, 2icw:H, 2oje:H, 1r5i:D, 1r5i:H

[Back]