QSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQF
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4rt4:D | 52 | 47 | 1.0000 | 0.9038 | 1.0000 | 2.16e-28 | 4riq:A, 4riq:B, 4riq:D, 4riq:E, 4riq:G, 4riq:H, 4riq:J, 4riq:K, 4riq:Z, 4riq:N, 4riq:P, 4riq:Q, 4riq:S, 4riq:T, 4riq:V, 4rt4:A, 4rt4:B |
2 | 6ven:P | 42 | 38 | 0.3191 | 0.3571 | 0.3947 | 3.01e-05 | |
3 | 6z0p:A | 242 | 40 | 0.3404 | 0.0661 | 0.4000 | 1.5 | 6z0p:B |
4 | 3nwn:A | 308 | 44 | 0.2979 | 0.0455 | 0.3182 | 2.8 | |
5 | 5h7y:A | 278 | 18 | 0.2128 | 0.0360 | 0.5556 | 3.7 | |
6 | 7jrj:I | 327 | 26 | 0.2128 | 0.0306 | 0.3846 | 3.7 |