QRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSG
TTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLV
TFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGR
THPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDAD
The query sequence (length=284) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2iry:A | 288 | 283 | 0.9965 | 0.9826 | 1.0000 | 0.0 | 2irx:A, 2iry:B, 4mky:B, 4mky:A, 4mky:C, 4mky:D, 3pky:A, 3pky:B, 2r9l:A, 2r9l:B |
2 | 6sa0:A | 333 | 261 | 0.2817 | 0.2402 | 0.3065 | 8.07e-28 | 6sa0:D, 6sa1:A, 6sa1:D |
3 | 2faq:A | 295 | 253 | 0.2535 | 0.2441 | 0.2846 | 5.67e-26 | 2faq:B, 2far:A, 2far:B |
4 | 2bru:B | 364 | 57 | 0.0634 | 0.0495 | 0.3158 | 3.9 | 1x14:B, 1x15:B |
5 | 6fp5:B | 86 | 24 | 0.0352 | 0.1163 | 0.4167 | 7.6 | 6fp5:A |