QRRRYFRISAPLHPPYFCQTKLADNSTLRFRLYDLSLGGMGALLETAKPAELQEGMRFAQIEVNMGQWGVFHFDAQLISI
SERKVIDGKNETITTPRLSFRFLNVSPTVERQLQRIIFSLEREAREKADKV
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5y6g:A | 131 | 131 | 1.0000 | 1.0000 | 1.0000 | 4.76e-96 | |
2 | 5y6f:A | 226 | 131 | 0.8779 | 0.5088 | 0.8779 | 2.58e-74 | |
3 | 6rm3:LI0 | 216 | 71 | 0.1679 | 0.1019 | 0.3099 | 1.0 | |
4 | 3qyq:A | 273 | 73 | 0.1756 | 0.0842 | 0.3151 | 1.3 | 3qyq:B |
5 | 3u1i:B | 168 | 44 | 0.1298 | 0.1012 | 0.3864 | 1.5 | 3u1i:D, 3u1j:B |
6 | 3kyf:A | 231 | 126 | 0.2290 | 0.1299 | 0.2381 | 3.1 | |
7 | 6jb1:B | 1366 | 91 | 0.1832 | 0.0176 | 0.2637 | 4.3 | 6jb1:D, 6jb1:F, 6jb1:H, 7wit:A, 5yw7:B, 5ywd:B |
8 | 6n1a:A | 386 | 90 | 0.1832 | 0.0622 | 0.2667 | 5.1 | 6n1b:A |