BioLiP

>protein
QQVWKLVIITEEILLKKVSKIIKEAGASGYTVLAAAGEGSAYSNIKFEVLTASRELADQIQDKVVAKYFDDYSCITYIST
VEALRAHKF

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6mmo:A	91	89	1.0000	0.9780	1.0000	3.10e-60	6mmc:A, 6mmo:B, 6mmo:C, 6mmo:E, 6mmo:D, 6mmo:F, 6mmq:A, 6mmq:D, 6mmq:B, 6mmq:C, 6mmq:F, 6mmq:E
2	6ntb:C	104	102	1.0000	0.8558	0.8725	8.65e-57	6mm2:A, 6ntb:A, 6ntb:B
3	7r30:B	102	87	0.5506	0.4804	0.5632	7.26e-30	5o3q:A, 5o3q:C, 5o3q:B, 5o3r:A, 5o3r:B, 5o3r:C, 7obj:C, 7r2y:A, 7r2y:B, 7r2z:A, 7r2z:B, 7r2z:C, 7r30:A, 7r30:C, 7r32:A
4	7cyf:D	109	98	0.5506	0.4495	0.5000	2.94e-28	7cyf:E, 7cyf:F, 7egk:D, 7egk:F, 7egk:B, 7obj:A, 7obj:B, 7r2y:C, 7r31:A, 7r31:B, 7r31:C, 7r32:B, 7r32:C
5	7o4x:A	103	39	0.1685	0.1456	0.3846	0.097
6	1z82:A	312	59	0.1685	0.0481	0.2542	0.13	1z82:B
7	5xkt:A	199	26	0.1011	0.0452	0.3462	2.7	5xkt:B
8	6n7e:C	302	54	0.2022	0.0596	0.3333	3.7	6n7e:B
9	4wa6:D	415	25	0.1124	0.0241	0.4000	4.7	4w4u:D
10	4fjc:E	434	25	0.1124	0.0230	0.4000	4.7	3m99:A, 3mhh:A
11	3mhs:A	455	25	0.1124	0.0220	0.4000	4.8	6aqr:A, 4fip:A, 4fip:E, 4fjc:A, 4fk5:A, 6t9l:K, 4w4u:A, 4wa6:A, 4zux:U, 4zux:Z, 4zux:e, 4zux:j
12	2e87:A	356	64	0.1685	0.0421	0.2344	5.2
13	1ovm:A	535	45	0.1798	0.0299	0.3556	6.5	1ovm:B, 1ovm:C, 1ovm:D
14	5kca:A	807	35	0.1348	0.0149	0.3429	6.9	5kc8:A
15	4eo3:A	321	21	0.1011	0.0280	0.4286	8.3	4eo3:B

[Back]