QPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVPRRYFCLQCHVS
The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jni:A | 62 | 62 | 1.0000 | 1.0000 | 1.0000 | 7.81e-43 | |
2 | 1ogy:B | 126 | 66 | 0.5484 | 0.2698 | 0.5152 | 7.48e-19 | 1ogy:D, 1ogy:F, 1ogy:H, 1ogy:J, 1ogy:L, 1ogy:N, 1ogy:P |
3 | 3ml1:B | 109 | 66 | 0.5000 | 0.2844 | 0.4697 | 2.03e-15 | 3o5a:B |
4 | 1hfe:L | 396 | 45 | 0.2419 | 0.0379 | 0.3333 | 0.059 | 8bj7:A, 8bj8:A, 1e08:A, 1gx7:A, 1hfe:M, 6sg2:AAA |
5 | 6qyc:B | 608 | 54 | 0.2581 | 0.0263 | 0.2963 | 0.46 | 6qyc:A, 6qyc:C, 6r2q:C |
6 | 1sp3:A | 436 | 22 | 0.1774 | 0.0252 | 0.5000 | 3.1 | |
7 | 5gll:A | 331 | 23 | 0.1613 | 0.0302 | 0.4348 | 3.4 | 5glk:B, 5glm:A, 5glm:B, 5gln:A, 5gln:B, 5glo:A, 5glo:B, 5glp:A, 5glp:B, 5glq:A, 5glq:B, 5glr:A, 5glr:B |
8 | 4lmh:D | 695 | 22 | 0.1452 | 0.0129 | 0.4091 | 3.4 | 4lmh:A, 4lmh:B, 4lmh:C |
9 | 1qdb:A | 473 | 53 | 0.2419 | 0.0317 | 0.2830 | 3.9 | 1qdb:B, 1qdb:C |
10 | 1qdb:A | 473 | 30 | 0.1613 | 0.0211 | 0.3333 | 7.2 | 1qdb:B, 1qdb:C |