QPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSLQMLEL
ITRLHQYIFSHILRYCVLPLNVSTLDIDFKFMEDIEKSEKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTD
LTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHSSAEKRKAKWESLQNKQILVPELCAIHPI
PASLWRKAVCLPSILYRLHC
The query sequence (length=260) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ngf:A | 260 | 262 | 0.9885 | 0.9885 | 0.9809 | 0.0 | 4ngf:B, 4ngf:C, 4ngf:D, 4nha:A |
2 | 7xw2:A | 725 | 298 | 1.0000 | 0.3586 | 0.8725 | 1.59e-178 | |
3 | 5zal:A | 1314 | 298 | 1.0000 | 0.1979 | 0.8725 | 1.17e-173 | 2eb1:A, 2eb1:B, 2eb1:C, 4ngd:A, 5zam:A |
4 | 7yym:A | 1281 | 288 | 0.9154 | 0.1858 | 0.8264 | 2.41e-155 | 4ngb:A, 4ngc:A, 4ngg:A, 4nh3:A, 4nh5:A, 4nh6:A, 7yyn:A, 7zpi:A, 7zpj:A, 7zpk:A |
5 | 8dg5:A | 1635 | 296 | 0.5115 | 0.0813 | 0.4493 | 1.23e-73 | 8dg7:A |
6 | 8dfv:A | 1664 | 296 | 0.5115 | 0.0799 | 0.4493 | 1.28e-73 | |
7 | 8dga:A | 1629 | 296 | 0.5115 | 0.0816 | 0.4493 | 1.79e-73 | |
8 | 8hf0:A | 1561 | 264 | 0.2500 | 0.0416 | 0.2462 | 8.39e-14 | 8hf0:D, 8hf1:A, 8hf1:D, 8hf1:G, 7w0a:A, 7w0a:E, 7w0c:A, 7w0d:A, 7w0e:A, 7w0f:A |
9 | 7w0b:A | 1586 | 264 | 0.2500 | 0.0410 | 0.2462 | 8.73e-14 | 7w0d:F |
10 | 7v6c:A | 1540 | 263 | 0.2308 | 0.0390 | 0.2281 | 1.11e-11 | |
11 | 7eld:A | 1137 | 115 | 0.1538 | 0.0352 | 0.3478 | 9.75e-10 | 7ele:A |
12 | 7vg3:A | 860 | 108 | 0.1231 | 0.0372 | 0.2963 | 1.76e-05 | 7vg2:A |
13 | 2l5d:A | 134 | 100 | 0.1077 | 0.2090 | 0.2800 | 1.02e-04 | 3o3i:X, 3o6e:X, 3o7v:X, 2xfm:A |
14 | 7kx9:A | 734 | 61 | 0.0846 | 0.0300 | 0.3607 | 0.002 | 7kx7:A, 7yfq:A, 7yg6:A |
15 | 6kr6:A | 713 | 61 | 0.0846 | 0.0309 | 0.3607 | 0.019 | |
16 | 5guh:A | 759 | 66 | 0.0885 | 0.0303 | 0.3485 | 0.13 | |
17 | 7yfx:A | 746 | 60 | 0.0731 | 0.0255 | 0.3167 | 0.80 | 7yfy:A, 7ygn:A |
18 | 8r3z:A | 755 | 32 | 0.0538 | 0.0185 | 0.4375 | 1.0 | |
19 | 3ss7:X | 437 | 85 | 0.0808 | 0.0481 | 0.2471 | 1.1 | 3ss9:X |
20 | 5bv9:A | 701 | 85 | 0.0885 | 0.0328 | 0.2706 | 1.9 | 5cvy:A, 5vma:A |
21 | 4lna:A | 269 | 162 | 0.1423 | 0.1375 | 0.2284 | 2.9 | |
22 | 7kw6:A | 697 | 106 | 0.1154 | 0.0430 | 0.2830 | 5.3 | |
23 | 2p4s:A | 282 | 58 | 0.0692 | 0.0638 | 0.3103 | 5.4 | 2p4s:B, 2p4s:C |
24 | 8om5:A | 828 | 125 | 0.1231 | 0.0386 | 0.2560 | 7.1 | 8omo:A |