QMLDESARLRLEARGELQALRIQRYFMDAFQYGKGFSRQILFLRDQAQKRFLDAYDLREDLTRQVRTALAANPEVLGLYV
VFEPNALDGKDELFVDQPALGSNDKGRFSLYWAQATPGQLESESMIESELADTSSGPSGAAYNAWYTCPKESGQPCVLDP
YFDKVGERQLLMTSIAFPLELDGKVIGVMGLDINLSNLQALSEQGNRELYDGVGQVGILSPAGLFAGNSRDAGLLGKNLA
KADPQHAGELLQLLAAGKSRLFNENDDLKVLQPLQPIPGAKPWGVLLEVPKSALLG
The query sequence (length=296) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6fu4:A | 297 | 296 | 1.0000 | 0.9966 | 1.0000 | 0.0 | 6fu4:B, 6fu4:C, 6fu4:D |
2 | 6f9g:D | 262 | 288 | 0.5135 | 0.5802 | 0.5278 | 7.02e-101 | 6f9g:A, 6f9g:B, 6f9g:C, 6f9g:E |
3 | 7prq:B | 316 | 298 | 0.2500 | 0.2342 | 0.2483 | 2.41e-30 | 7prq:A, 7prr:A, 7prr:B |
4 | 6d8v:A | 269 | 148 | 0.1520 | 0.1673 | 0.3041 | 9.79e-13 | |
5 | 6py3:B | 238 | 154 | 0.1318 | 0.1639 | 0.2532 | 0.003 | 6pxy:A, 6py3:A, 6py4:A, 6py5:A, 6pyi:A, 6q0f:A, 6q0g:A |
6 | 6w3o:B | 252 | 74 | 0.0811 | 0.0952 | 0.3243 | 0.018 | 6w3o:A, 6w3p:A, 6w3p:B, 6w3r:A, 6w3r:B, 6w3s:A, 6w3s:B, 6w3t:A, 6w3t:B, 6w3v:A, 6w3v:B, 6w3x:A, 6w3x:B, 6w3y:A, 6w3y:B, 4xmr:A, 4xmr:B |
7 | 8bmv:B | 249 | 252 | 0.2061 | 0.2450 | 0.2421 | 0.095 | 8bmv:A |
8 | 4wy9:A | 285 | 130 | 0.1047 | 0.1088 | 0.2385 | 0.11 | |
9 | 5lt9:B | 253 | 54 | 0.0541 | 0.0632 | 0.2963 | 0.36 | 5lt9:A, 5lto:A, 5lto:B |
10 | 4c9f:D | 134 | 140 | 0.1182 | 0.2612 | 0.2500 | 0.41 | 4c9f:A, 4c9f:B, 4c9f:C, 4caj:A, 4caj:B, 4caj:C, 4caj:D, 3zhg:A, 3zhg:B, 3zhg:C, 3zhg:D |
11 | 5ave:A | 252 | 82 | 0.0845 | 0.0992 | 0.3049 | 1.3 | 5avf:A, 5avf:B, 3c8c:A, 3c8c:B, 6iov:A, 6iov:B |
12 | 6d24:A | 502 | 64 | 0.0709 | 0.0418 | 0.3281 | 2.1 | 5aq1:A, 5aq1:B, 5aq1:C, 6d24:B, 6d24:C, 6d24:D |
13 | 8dgd:A | 167 | 40 | 0.0507 | 0.0898 | 0.3750 | 2.2 | |
14 | 6raw:5 | 576 | 89 | 0.0777 | 0.0399 | 0.2584 | 2.5 | |
15 | 5ah5:A | 789 | 38 | 0.0405 | 0.0152 | 0.3158 | 3.8 | 5ah5:B |
16 | 5a29:A | 548 | 17 | 0.0372 | 0.0201 | 0.6471 | 5.6 | |
17 | 7ukn:A | 1059 | 99 | 0.1014 | 0.0283 | 0.3030 | 5.9 | |
18 | 5oc2:A | 441 | 50 | 0.0642 | 0.0431 | 0.3800 | 9.7 | 5oc2:B, 5oc3:A, 5oc3:B, 4wct:A, 4wct:B, 4xwz:A, 4xwz:B |