QLSTDAERELANIWATVLDIPIGTISASDNFFFRGGHSIDAMKASALGRAAGMSFGVADIFDHPVLSELASVAV
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ejd:G | 75 | 74 | 1.0000 | 0.9867 | 1.0000 | 4.86e-49 | 5ejd:E, 5ejd:K, 5ejd:M, 5ejd:O |
2 | 8jbr:A | 1023 | 70 | 0.3919 | 0.0283 | 0.4143 | 4.26e-10 | |
3 | 7ly7:A | 908 | 64 | 0.3243 | 0.0264 | 0.3750 | 6.50e-07 | |
4 | 6mg0:B | 1687 | 69 | 0.3378 | 0.0148 | 0.3623 | 7.34e-07 | |
5 | 6mfz:A | 1789 | 67 | 0.2973 | 0.0123 | 0.3284 | 1.09e-06 | 5es7:A, 5es8:A, 5es8:B, 5es9:A, 6mfw:A, 6mfx:A, 6mfy:A, 6mg0:A, 6ulz:A |
6 | 6mfz:A | 1789 | 67 | 0.2838 | 0.0117 | 0.3134 | 2.81e-04 | 5es7:A, 5es8:A, 5es8:B, 5es9:A, 6mfw:A, 6mfx:A, 6mfy:A, 6mg0:A, 6ulz:A |
7 | 4r0m:A | 637 | 68 | 0.2838 | 0.0330 | 0.3088 | 3.11e-06 | 4r0m:B |
8 | 4mrt:C | 77 | 66 | 0.3108 | 0.2987 | 0.3485 | 3.36e-05 | |
9 | 2vsq:A | 1273 | 68 | 0.2838 | 0.0165 | 0.3088 | 1.98e-04 | |
10 | 5isx:A | 529 | 63 | 0.2703 | 0.0378 | 0.3175 | 2.88e-04 | 5isx:B |
11 | 7en2:B | 1410 | 65 | 0.3378 | 0.0177 | 0.3846 | 6.85e-04 | 7emy:A, 7emy:B, 7en1:A, 7en1:B, 7en2:A |
12 | 8g3i:B | 515 | 69 | 0.3243 | 0.0466 | 0.3478 | 7.52e-04 | |
13 | 5u89:A | 1039 | 64 | 0.2703 | 0.0192 | 0.3125 | 0.002 | |
14 | 8w2d:A | 322 | 43 | 0.2297 | 0.0528 | 0.3953 | 0.020 | 8w2d:B |
15 | 4dg9:A | 575 | 56 | 0.2432 | 0.0313 | 0.3214 | 0.026 | 4dg8:A |
16 | 6vtj:A | 472 | 69 | 0.3108 | 0.0487 | 0.3333 | 0.028 | |
17 | 6ltb:A | 928 | 48 | 0.2162 | 0.0172 | 0.3333 | 0.26 | 6ltc:A, 6ltd:A, 6ltd:B |
18 | 4zxh:A | 1314 | 67 | 0.2568 | 0.0145 | 0.2836 | 0.46 | 4zxi:A |
19 | 7eo3:A | 282 | 26 | 0.1351 | 0.0355 | 0.3846 | 1.1 | |
20 | 7dog:A | 319 | 36 | 0.1622 | 0.0376 | 0.3333 | 1.4 | 7dog:B |
21 | 8umv:A | 546 | 57 | 0.1892 | 0.0256 | 0.2456 | 1.8 | 8umw:A, 8umy:A, 8un0:A |
22 | 6n8e:A | 1332 | 46 | 0.2162 | 0.0120 | 0.3478 | 4.5 | |
23 | 6tit:A | 432 | 74 | 0.2973 | 0.0509 | 0.2973 | 4.7 | 5i2m:C, 5oyl:A |
24 | 3v76:A | 390 | 47 | 0.2027 | 0.0385 | 0.3191 | 6.4 | |
25 | 5ja2:A | 1238 | 47 | 0.2027 | 0.0121 | 0.3191 | 8.4 | 5ja1:A, 5t3d:A |
26 | 6u7l:A | 460 | 21 | 0.1351 | 0.0217 | 0.4762 | 8.5 | 6u7l:B, 6u7l:C, 6u7l:D |
27 | 3sfw:A | 461 | 83 | 0.3919 | 0.0629 | 0.3494 | 8.5 | 3sfw:B |
28 | 3g5t:A | 299 | 19 | 0.1351 | 0.0334 | 0.5263 | 8.9 |