QLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSA
KEDAIAFAEKNGWSYDVEEKKVPKPKSKSYGANFSWNK
The query sequence (length=118) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7dh0:G | 123 | 116 | 0.9322 | 0.8943 | 0.9483 | 4.78e-81 | 7dkf:G2, 8ic2:Q, 8ic3:Q |
2 | 8esw:S4 | 126 | 117 | 0.5424 | 0.5079 | 0.5470 | 1.87e-45 | |
3 | 7arc:Q | 162 | 120 | 0.4576 | 0.3333 | 0.4500 | 2.81e-25 | 7ard:Q |
4 | 4iwh:A | 358 | 49 | 0.1186 | 0.0391 | 0.2857 | 0.13 | 4iwh:B, 4xxv:A, 4xxv:B |
5 | 6u2a:A | 358 | 48 | 0.1441 | 0.0475 | 0.3542 | 0.20 | 6ue4:A, 6ue4:B |
6 | 8p23:B | 715 | 36 | 0.1017 | 0.0168 | 0.3333 | 1.1 | 8p23:A, 8p27:A, 8p27:B, 8p28:A, 8p28:B, 8p28:C, 8p28:D, 8p2c:A, 8p2c:B, 8p2c:C, 8p2c:D, 8p2d:A, 8p2d:B, 8p2s:A, 8p2s:B, 8p39:A, 8p39:B |
7 | 7shk:L | 282 | 58 | 0.1525 | 0.0638 | 0.3103 | 3.3 | 7shl:L |
8 | 5aa5:G | 561 | 40 | 0.0932 | 0.0196 | 0.2750 | 4.7 | 5aa5:C, 5aa5:E, 5aa5:K, 5aa5:I, 5aa5:L |
9 | 4pfu:B | 542 | 84 | 0.1864 | 0.0406 | 0.2619 | 8.4 | 5hm4:B, 4pfu:A, 4pfw:A, 4pfw:B |
10 | 3dy5:A | 1002 | 39 | 0.1102 | 0.0130 | 0.3333 | 8.5 | 3dy5:C, 1u5u:A, 1u5u:B |