BioLiP

>protein
QKVAIVREDTGTIAELAEKALGNMVDIVYAGSDLKEAEEAVKKEKAPAIIVIPKGFSQSLESGEKARLEIVWYLRGTGLS
EAVSTGTISSLIESLKVQLASFLLNDPKKAQLLFDPLEIVQHTYLRGSLFKNHSPEAIMNVFYSQ

The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3cni:A	145	145	1.0000	1.0000	1.0000	5.56e-104
2	4lej:A	355	110	0.1724	0.0704	0.2273	0.21
3	7r7j:B	574	27	0.0897	0.0226	0.4815	0.37	8h5y:B, 8h5y:A, 8h5z:B, 8h5z:A, 6jde:B, 6jde:A, 7r7j:A
4	7aor:e	810	61	0.1379	0.0247	0.3279	0.43
5	7l08:s	393	43	0.0828	0.0305	0.2791	2.4	8any:s, 7l20:s, 7o9m:s, 7odr:s, 7ods:s, 7odt:s, 8oir:Bi, 8oit:Bi, 8pk0:s, 7po4:s, 7qi4:s, 7qi5:s, 7qi6:s, 8qsj:s, 6vlz:s, 6vmi:s, 6zm5:s, 6zm6:s
6	7a5f:s3	370	42	0.0828	0.0324	0.2857	2.5	7a5g:s3, 7a5h:s, 7a5i:s3, 7a5j:s, 7a5k:s3, 6i9r:s, 3j7y:s, 3j9m:s, 8k2a:Sf, 8k2b:Sf, 6nu2:s, 6nu3:s, 7o9k:s, 7of0:s, 7of2:s, 7of3:s, 7of4:s, 7of5:s, 7of6:s, 7of7:s, 7og4:s, 7oi6:s, 7oi7:s, 7oi8:s, 7oi9:s, 7oia:s, 7oib:s, 7oic:s, 7oid:s, 7oie:s, 5ool:s, 5oom:s, 7pd3:s, 7qh6:s, 7qh7:s, 8qu5:s, 8xt0:Sf, 8xt1:Sf, 8xt2:Sf, 8xt3:Sf, 6zs9:s, 6zsa:s, 6zsb:s, 6zsc:s, 6zsd:s, 6zse:s, 6zsg:s
7	8vdk:A	432	53	0.1310	0.0440	0.3585	3.1
8	2bvf:A	453	65	0.1448	0.0464	0.3231	3.9	2bvf:B, 2bvg:A, 2bvg:B, 2bvg:C, 2bvg:D, 2bvh:A, 2bvh:B, 2bvh:C, 2bvh:D
9	7vw6:B	560	59	0.1172	0.0304	0.2881	5.1	7e5z:B, 8j83:B, 7xqw:B
10	6kr6:A	713	63	0.1172	0.0238	0.2698	7.5
11	4bt2:A	237	69	0.1517	0.0928	0.3188	7.7	4bt3:A, 4bt4:A, 4bt5:A, 4bt6:A, 4bt7:A
12	2ea7:A	390	60	0.1103	0.0410	0.2667	9.7	2ea7:B, 2ea7:C, 2eaa:A, 2eaa:B, 2eaa:C

[Back]