Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
QKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEM
KLVAQKVID

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 2wh5:A 90 89 1.0000 0.9889 1.0000 3.57e-64 2wh5:B, 2wh5:C, 2wh5:D, 2wh5:F, 2wh5:E
2 3flv:A 92 87 0.6404 0.6196 0.6552 5.02e-42 3flv:B
3 3fp5:A 106 84 0.3933 0.3302 0.4167 1.19e-21
4 1aca:A 86 86 0.4157 0.4302 0.4302 1.49e-19 2cb8:A, 2cb8:B, 2fj9:A, 1nvl:A
5 7fc7:A 96 84 0.3820 0.3542 0.4048 1.64e-14
6 3epy:A 88 86 0.3483 0.3523 0.3605 2.58e-12 3epy:B
7 1hbk:A 89 74 0.3146 0.3146 0.3784 8.34e-11
8 3dye:A 302 52 0.1685 0.0497 0.2885 0.45 3dzt:A
9 7plo:K 639 33 0.1348 0.0188 0.3636 1.3 8b9d:K, 7pfo:K
10 6cus:A 87 53 0.1910 0.1954 0.3208 1.6 6cv8:A, 6cw4:A
11 8oui:C 429 33 0.1348 0.0280 0.3636 2.4 8oui:B
12 8xqw:A 988 37 0.1461 0.0132 0.3514 2.5
13 1w6s:D 72 40 0.1236 0.1528 0.2750 9.3

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417