BioLiP

>protein
QIQHIAIVGCVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLT
LFIGGNAESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQM
LSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHF
IALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGL
KIIYDSDTFDIQFTSRRFYIEKIYNEL

The query sequence (length=347) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5k78:B	351	347	1.0000	0.9886	1.0000	0.0	8dzk:A, 8dzk:B, 8dzk:C, 8dzk:D, 8dzk:E, 5k73:A, 5k73:B, 5k73:C, 5k73:D, 5k73:E, 5k77:A, 5k77:B, 5k77:C, 5k77:D, 5k77:E, 5k78:C, 5k78:D, 5k78:A, 5k78:E, 4pef:A, 4pef:B, 4pef:C, 4pef:D, 4pef:E, 4peg:A, 4peg:B, 4peg:C, 4peg:D, 4peg:E, 4peh:A, 4peh:B, 4peh:C, 4peh:D, 4peh:E, 4pei:A, 4pei:B, 4pei:C, 4pei:D, 4pei:E, 5uki:A
2	5tcv:A	299	65	0.0490	0.0569	0.2615	2.4	1wa6:X
3	8b0i:C	242	28	0.0346	0.0496	0.4286	4.1
4	3j79:E	380	55	0.0403	0.0368	0.2545	4.6	3jbn:AE, 3jbo:AE, 3jbp:AE, 8tpu:AE, 5umd:E
5	8b0i:D	282	28	0.0346	0.0426	0.4286	4.6	8b0i:A, 8b0i:B, 8b0j:A, 8b0j:B, 8b0j:D, 8b0j:C
6	7sci:A	487	86	0.0720	0.0513	0.2907	7.6	7yx8:A, 7yx8:B
7	4eqb:A	323	39	0.0403	0.0433	0.3590	8.4	4eqb:B
8	5n7d:A	423	67	0.0461	0.0378	0.2388	9.2	2i04:A, 2i04:B, 5n7d:B, 5n7f:A, 5n7f:B, 5n7g:A, 7p71:A, 7p71:B, 6twq:B, 6twq:A, 6twu:B, 6twu:A, 6twx:B, 6twx:A, 6twy:B, 6twy:A

[Back]