QGLLQDIEKRILHYKQLFFKEQNEIANGKRSMVPDNSIPICSDVTKLNFQALIDAQMRHAGKMFDVIMMDPPWQLDSLSD
EKIQNMPIQSLQQDGFIFVWAINAKYRVTIKMIENWGYKLVDEITWVKKTVKIAKGHGFYLQHAKESCLIGVKGDVDNGR
FKKNIASDVIFSERRGQSQKPEEIYQYINQLCPNGNYLEIFARRNNLHDNWVSIGNEL
The query sequence (length=218) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7yi8:B | 223 | 223 | 1.0000 | 0.9776 | 0.9776 | 4.41e-161 | 7f4p:A, 7f4q:A, 7f4t:A, 7f4t:E, 7f4t:H, 7f4t:K, 7yi9:B |
| 2 | 7f4m:D | 216 | 218 | 0.9266 | 0.9352 | 0.9266 | 6.05e-146 | 7f4l:C, 7f4m:C, 7f4n:C, 7f4n:D |
| 3 | 5k7u:A | 208 | 190 | 0.3165 | 0.3317 | 0.3632 | 6.68e-37 | 7acd:A, 8bn8:AAA, 5il1:A, 5il2:A, 5k7w:A, 5l6d:A, 5l6e:A, 7nhg:A, 7nhh:A, 7nhi:A, 7nhj:A, 7nhv:A, 7ni7:A, 7ni8:A, 7ni9:A, 7nia:A, 7nid:A, 7o08:A, 7o09:A, 7o0l:A, 7o0m:A, 7o0p:A, 7o0q:A, 7o0r:A, 7o27:A, 7o28:A, 7o29:A, 7o2e:A, 7o2f:A, 7o2h:A, 7o2i:A, 7o2x:A, 7oed:A, 7oee:A, 7oef:A, 7oeg:A, 7oeh:A, 7oei:A, 7oej:A, 7oek:A, 7oel:A, 7oem:A, 7oql:A, 7oqo:A, 7oqp:A, 8pw8:A, 8pw9:A, 8pwa:A, 8pwb:A, 5tey:A, 6ttp:A, 6ttt:A, 6ttv:A, 6ttw:A, 6ttx:A, 6tu1:A, 6y4g:A |
| 4 | 7ni7:B | 246 | 201 | 0.2523 | 0.2236 | 0.2736 | 1.39e-14 | 7acd:B, 7nhh:B, 7o0q:B, 7oem:B, 8pwa:B |
| 5 | 7cv9:A | 356 | 215 | 0.2477 | 0.1517 | 0.2512 | 8.61e-05 | 7cv6:B, 7cv7:A, 7cv7:B |
| 6 | 7cv9:C | 351 | 220 | 0.2431 | 0.1510 | 0.2409 | 1.99e-04 | 7cv8:A, 7dpe:A |
| 7 | 7dsu:B | 420 | 123 | 0.1376 | 0.0714 | 0.2439 | 0.63 | 7dsu:A |
| 8 | 4h83:F | 368 | 72 | 0.0963 | 0.0571 | 0.2917 | 1.7 | 4h83:A, 3no1:A, 3no1:B, 3no1:C, 3no1:D, 3no1:E, 3no1:F |
| 9 | 1zun:A | 204 | 109 | 0.1147 | 0.1225 | 0.2294 | 2.4 | |
| 10 | 1h6d:A | 383 | 48 | 0.0780 | 0.0444 | 0.3542 | 2.6 | 1evj:A, 1evj:B, 1evj:C, 1evj:D, 1h6a:A, 1h6a:B, 1h6b:A, 1h6b:B, 1h6c:A, 1h6c:B, 1h6d:C, 1h6d:B, 1h6d:D, 1h6d:E, 1h6d:G, 1h6d:F, 1h6d:H, 1h6d:I, 1h6d:K, 1h6d:J, 1h6d:L, 1ofg:A, 1ofg:D, 1ofg:B, 1ofg:C, 1ofg:E, 1ofg:F, 1ryd:A, 1ryd:B, 1rye:A, 1rye:D, 1rye:B, 1rye:C |
| 11 | 3fxb:A | 310 | 51 | 0.0505 | 0.0355 | 0.2157 | 5.6 | 3fxb:B |
| 12 | 4as5:A | 274 | 171 | 0.1789 | 0.1423 | 0.2281 | 5.9 | 4as5:B, 4as5:C, 4as5:D |
umich.edu