BioLiP

>protein
QGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDW
TALRLQKLLQDNNVMFNTEPPGCRVIEQRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERY
LHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK

The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6sc6:A	365	204	0.9899	0.5397	0.9657	7.38e-144	5edv:A, 5edv:B, 6gzy:A, 6gzy:B, 6kc5:B, 6kc6:A, 6kc6:C, 6kc6:E, 6kc6:G, 6kc6:I, 6kc6:K, 4ljo:A, 4ljp:A, 4ljq:B, 4ljq:C, 4ljq:A, 4ljq:D, 6sc5:A, 6sc7:A, 6sc8:A, 6sc9:A, 7v8f:B, 7v8g:D, 7v8g:C
2	7od1:A	430	41	0.0854	0.0395	0.4146	4.76e-04	7od1:B
3	5ait:A	129	68	0.1055	0.1628	0.3088	0.89	5aiu:A, 4ap4:A, 3ng2:A, 3ng2:B, 4ppe:A, 4ppe:B, 2xeu:A
4	2djb:A	72	32	0.0653	0.1806	0.4062	0.93
5	1k12:A	158	31	0.0503	0.0633	0.3226	1.4
6	3ayx:A	595	68	0.0804	0.0269	0.2353	4.1	3ayx:C, 3ayz:A, 3ayz:C, 5y34:A, 5y34:C
7	2yqm:A	89	66	0.0955	0.2135	0.2879	4.9	2yw8:A
8	7enc:0	306	53	0.0704	0.0458	0.2642	6.7	1g25:A, 8gxq:HD, 8gxs:HD, 6nmi:H, 7nvw:3, 7nvx:3, 7nvy:3, 7nvz:3, 8wak:0, 8wal:0, 8wan:0, 8wao:0, 8wap:0, 8waq:0, 8war:0, 8was:0
9	7lbm:d	275	53	0.0704	0.0509	0.2642	7.2	8byq:7
10	5c1z:A	384	33	0.0704	0.0365	0.4242	8.8	4bm9:A, 5c1z:B, 5c23:A, 5c23:B, 5c9v:A, 6glc:A, 6hue:A, 6hue:B, 4i1f:A, 4i1h:A, 8ik6:C, 8ikm:A, 8ikt:A, 8ikv:C, 8ikv:A, 8jwv:A, 5n2w:A, 5n38:A, 8wzn:A, 8wzo:A
11	7egb:0	236	53	0.0704	0.0593	0.2642	9.2	7egc:0
12	7nvr:3	214	53	0.0704	0.0654	0.2642	9.2
13	3cxc:Y	73	34	0.0603	0.1644	0.3529	9.9	1jj2:Y, 1k73:1, 1k8a:1, 1k9m:1, 1kc8:1, 1kd1:1, 1kqs:Y, 1m1k:1, 1m90:1, 1n8r:1, 1nji:1, 3ow2:Y, 1q7y:1, 1q81:1, 1q82:1, 1q86:1, 1qvf:Y, 1qvg:Y, 1w2b:Y
14	5caw:C	315	33	0.0804	0.0508	0.4848	9.9	5caw:A

[Back]