QFIFEDVPQRNAATFNPEVGYVAFIGKYGQQLNFGVARVFFLNQKKAKMVLHKTAQPSVDLTFGGVKFTVVNNHFPQYVS
NPVPDNAITLHRMSGYLARWIADTCKASVLKLAEASAQIVMPLAEVKGCTWADGYTMYLGFAPGAEMFLDAFDFYPLVIE
MHRVLKDNMDVNFMKKVLRQRYGTMTAEEWMTQKITEIKAAFNSVGQLAWAKSGFSPAARTFLQQF
The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4jng:A | 226 | 226 | 1.0000 | 1.0000 | 1.0000 | 1.43e-172 | 4jng:B, 4jng:C, 4jng:D |
2 | 4j1j:C | 234 | 226 | 0.5310 | 0.5128 | 0.5310 | 2.68e-90 | 4j1g:A, 4j1g:D, 4j1g:C, 4j1g:B, 4j1j:A, 4j1j:B, 4j1j:D |
3 | 4bhh:F | 232 | 228 | 0.4381 | 0.4267 | 0.4342 | 1.01e-65 | 4bhh:B, 4bhh:D, 4bhh:Z |
4 | 4ijs:A | 232 | 228 | 0.4027 | 0.3922 | 0.3991 | 4.70e-59 | 4ijs:B, 4ijs:C, 4ijs:D, 3zla:A, 3zla:B, 3zla:C, 3zla:D, 3zla:E, 3zla:F, 3zla:G, 3zla:H |
5 | 3rgz:A | 745 | 88 | 0.1106 | 0.0336 | 0.2841 | 0.95 | 4lsa:A, 4lsx:A, 4lsx:B, 4m7e:A, 4m7e:B, 3rj0:A |
6 | 6yxy:EQ | 471 | 85 | 0.1150 | 0.0552 | 0.3059 | 2.9 |