QERLEKIKQRDKRLEWEMMCRVKPDVVQDKETERNLQRIATRGVVQLFNAVQKHQKNVDEKVKEAGSSMRKRAKLISTVS
KKDFISVLR
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8fkp:NG | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 2.79e-60 | 8fkq:NG, 8fkr:NG, 8fks:NG |
2 | 8i9r:Ch | 71 | 64 | 0.2697 | 0.3380 | 0.3750 | 6.47e-04 | 8i9t:Ch |
3 | 8qzc:A | 701 | 66 | 0.2247 | 0.0285 | 0.3030 | 2.2 | 8qzc:B |
4 | 7zk3:A | 721 | 66 | 0.2247 | 0.0277 | 0.3030 | 2.5 | 7b5c:A, 7b5c:B, 7b5e:A, 7b5e:B, 5oyb:A, 5oyb:B, 7zk3:B |
5 | 7u6j:B | 248 | 32 | 0.1461 | 0.0524 | 0.4062 | 6.2 | 7u6i:A, 7u6j:A, 7u6j:C, 7u6j:D, 7u6j:E, 7u6j:F, 7u6j:G, 7u6j:H |
6 | 4wxj:B | 254 | 81 | 0.2247 | 0.0787 | 0.2469 | 7.5 | 4wxj:A |