QEPSSKRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQLRQKVRQLEEELRIL
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1gd2:E | 65 | 64 | 1.0000 | 0.9846 | 1.0000 | 1.30e-39 | 1gd2:F, 1gd2:G, 1gd2:H |
2 | 1gd2:I | 40 | 58 | 0.6094 | 0.9750 | 0.6724 | 1.80e-14 | |
3 | 3ffz:A | 1246 | 51 | 0.2969 | 0.0152 | 0.3725 | 0.055 | 3d3x:A, 3d3x:B, 3ffz:B, 7ovw:AAA, 7ovw:BBB, 1t3a:A, 1t3a:B, 1t3c:A, 1t3c:B, 7uib:D, 7uib:A, 1zkw:A, 1zkw:B, 1zkx:A, 4zkt:A, 4zkt:C, 4zkt:E, 1zl6:A, 1zn3:A |
4 | 7k84:A | 793 | 51 | 0.2969 | 0.0240 | 0.3725 | 0.11 | |
5 | 5t01:A | 62 | 58 | 0.2969 | 0.3065 | 0.3276 | 0.27 | 1a02:J, 1fos:F, 1fos:H, 5fv8:D, 2h7h:A, 2h7h:B, 1jnm:A, 1jnm:B, 1s9k:E, 5t01:B |
6 | 8j07:8P | 360 | 61 | 0.3438 | 0.0611 | 0.3607 | 0.61 | |
7 | 5vpe:D | 67 | 60 | 0.3438 | 0.3284 | 0.3667 | 0.76 | 5vpe:B, 5vpf:B, 5vpf:D |
8 | 1m1j:C | 390 | 38 | 0.2031 | 0.0333 | 0.3421 | 1.7 | 1m1j:F |
9 | 3gp8:A | 551 | 39 | 0.2344 | 0.0272 | 0.3846 | 3.0 | 3gpl:A, 3gpl:B |
10 | 7k1j:A | 3584 | 32 | 0.2188 | 0.0039 | 0.4375 | 3.4 | 7k19:A |
11 | 7k1k:A | 3604 | 54 | 0.2812 | 0.0050 | 0.3333 | 5.5 | 7k1b:A |
12 | 8iyj:B5 | 203 | 54 | 0.3125 | 0.0985 | 0.3704 | 5.8 | |
13 | 6zhe:A | 3768 | 54 | 0.2656 | 0.0045 | 0.3148 | 8.3 | |
14 | 1a0r:B | 339 | 17 | 0.1406 | 0.0265 | 0.5294 | 8.4 | 7e9h:B, 8jd6:B, 6rmv:A, 7tmw:B, 1xhm:A |
15 | 7kya:A | 1174 | 56 | 0.2188 | 0.0119 | 0.2500 | 8.7 | 7ky5:A, 7ky7:A, 7ky8:A, 7ky9:A |
16 | 1ynp:B | 298 | 36 | 0.1719 | 0.0369 | 0.3056 | 9.3 | 1ynp:A, 1ynq:A, 1ynq:B |