BioLiP

>protein
QENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKS
RVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRD
REVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEGHIIPRSLDLLGLEKLDCGRFP
SDHWGLLCNLDII

The query sequence (length=253) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5ino:A	253	253	1.0000	1.0000	1.0000	0.0	5ino:B, 5j3p:A, 5j3s:A
2	5j3p:B	229	248	0.8972	0.9913	0.9153	2.49e-162
3	4puq:A	256	252	0.7708	0.7617	0.7738	9.17e-149	4gyz:A, 4gyz:B, 4gyz:C, 4gyz:D, 4gyz:I, 4gyz:E, 4gyz:G, 4gyz:H, 4gz0:B, 4gz0:I, 4gz0:A, 4gz0:G, 4gz0:E, 4gz0:K, 4gz1:B, 4gz1:A, 4gz2:A, 4gz2:B, 5ht2:B, 5ht2:A, 5ink:B, 5ink:A, 5inl:B, 5inl:A, 5inm:A, 5inm:B, 5inm:D, 5inm:E, 5inp:B, 5inp:A, 5inq:B, 5inq:A, 5j3z:A, 5j3z:B, 5j42:A, 5j42:B, 4puq:B, 5tvp:I, 5tvp:O, 5tvp:G, 5tvp:E, 5tvp:B, 5tvp:A, 5tvp:K, 5tvp:M, 5tvq:A
4	4fpv:B	257	248	0.5731	0.5642	0.5847	2.50e-109	6ca4:A, 6ca4:B, 4f1h:A, 4f1h:B, 4fpv:A
5	6ca4:C	229	248	0.5573	0.6157	0.5685	5.06e-100
6	4fva:C	251	248	0.3320	0.3347	0.3387	5.51e-41	4fva:A, 4fva:B, 4fva:D
7	6nf0:A	298	258	0.2253	0.1913	0.2209	4.47e-04	6bt2:A
8	4ruw:A	386	292	0.2609	0.1710	0.2260	5.18e-04
9	6bt2:B	271	267	0.2292	0.2140	0.2172	0.010

[Back]