BioLiP

>protein
QDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKE

The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5la4:A	508	74	1.0000	0.1457	1.0000	4.52e-45	8b0b:AAA, 8b0b:BBB, 8b0c:AAA, 8b0c:BBB, 8bac:AAA, 8bac:BBB, 8cqi:A, 8cqi:B, 8e07:A, 8e07:B, 8e08:A, 8e08:B, 5e8m:A, 5e97:A, 5e97:B, 5e98:A, 5e98:B, 5e9b:A, 5e9b:B, 5e9c:A, 5e9c:B, 8jyg:A, 8jyg:B, 5l9y:A, 5l9y:B, 5l9z:A, 5l9z:B, 5la7:A, 8ohq:AAA, 8ohq:BBB, 8ohr:AAA, 8ohr:BBB, 7pr7:A, 7pr7:B, 7pr8:A, 7pr8:B, 7prt:A, 7prt:B, 7yi7:A, 7yi7:B, 7yjc:A, 7yjc:B, 6zdm:AAA, 6zdm:BBB
2	8vcd:A	321	68	0.2297	0.0530	0.2500	0.086
3	7kiu:A	263	29	0.1622	0.0456	0.4138	2.6	7kiu:B, 7kiu:C, 7kiu:D
4	7wrg:A	812	61	0.2297	0.0209	0.2787	5.2
5	7wrg:B	783	36	0.1486	0.0140	0.3056	7.4
6	6gwi:B	450	19	0.1351	0.0222	0.5263	7.7	6gwi:A
7	3ml5:A	262	80	0.3243	0.0916	0.3000	7.9	6g4t:A, 6h36:A, 6h37:A, 6h38:A, 3mdz:A, 7nc4:A, 7p1a:A, 8q3u:A, 6sdt:A, 6zr9:A
8	3t2d:A	390	45	0.1892	0.0359	0.3111	8.2	3t2b:A, 3t2c:A, 3t2e:A, 3t2f:A, 3t2g:A
9	3a20:A	122	19	0.1351	0.0820	0.5263	8.4	3a20:B, 3a6q:A, 3a6q:B, 3a6r:A, 3a6r:B, 3a6r:C, 3a6r:D, 3amf:A, 3amf:B, 3awh:A, 3awh:B, 1axj:A, 2e83:A, 2e83:B, 1flm:A, 1flm:B, 3vy2:A, 3vy2:B, 3vy5:A, 3vy5:B, 3vya:A, 1wli:A, 1wli:B, 1wlk:A, 1wlk:B, 1wlk:C, 1wlk:D

[Back]