QDDSTPDSLFAGLVGEYYGTNSQLNNISDFRALVDSKEADATFEAANISYGRGSSDVAKGTHLQEFLGSDASTLSTDPGD
NTDGGIYLQGYVYLEAGTYNFKVTADDGYEITINGNPVATVDNNQSVYTVTHASFTISESGYQAIDMIWWDQGGDYVFQP
TLSADGGSTYFVLDSAILSSTGETPY
The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5j6y:A | 188 | 186 | 1.0000 | 0.9894 | 1.0000 | 3.81e-134 | 6x7j:A, 6x7t:A, 6x7x:A, 6x7y:A, 6x7z:A, 6x8a:A, 6x8d:A, 6x8y:A, 6x95:A, 6x9m:A, 6x9p:A, 6xa5:A, 6xac:A, 6xaq:A |
2 | 6m8m:A | 177 | 162 | 0.3548 | 0.3729 | 0.4074 | 5.19e-36 | |
3 | 3sfz:A | 1133 | 74 | 0.1237 | 0.0203 | 0.3108 | 0.055 | 3shf:A |
4 | 6w1f:A | 280 | 93 | 0.1559 | 0.1036 | 0.3118 | 0.091 | 7ji0:A, 7ji0:B, 6w1f:B |
5 | 3qgv:A | 435 | 48 | 0.0806 | 0.0345 | 0.3125 | 0.90 | |
6 | 3ndz:A | 345 | 36 | 0.0538 | 0.0290 | 0.2778 | 2.9 | 3ndz:C, 3ndz:B, 3ndz:D |
7 | 2wt0:A | 300 | 34 | 0.0753 | 0.0467 | 0.4118 | 3.8 | 2wsv:A, 2wt1:A, 2wt2:A, 2wt2:B |
8 | 6akz:A | 451 | 45 | 0.0806 | 0.0333 | 0.3333 | 5.0 | |
9 | 3sqs:A | 386 | 47 | 0.0860 | 0.0415 | 0.3404 | 7.7 |