PYEPLIDWFTRHEEVMPLTAVPEPKRRFVPSKNEAKRVMKIVRAIREGRIIPPKKLKEMKEKEKIENYQYDLPPTNEESY
NPPEEYLLSPEEKEAWENTEYSERERNFIPQKYSALRKVPGYGESIRERFERSLDLY
The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8v83:m | 211 | 147 | 1.0000 | 0.6493 | 0.9320 | 3.26e-91 | 8v84:m |
2 | 6elz:m | 645 | 157 | 1.0000 | 0.2124 | 0.8726 | 6.45e-87 | 6em5:m, 7ohr:m, 7ohv:m |
3 | 7nac:m | 666 | 157 | 0.9708 | 0.1997 | 0.8471 | 4.07e-82 | 8e5t:s, 6em1:m, 6em3:B, 7nad:m, 7ohp:m, 7ohs:m, 7ohw:m, 7ohx:m, 7r6q:m, 7r72:m, 7r7a:m, 8v87:m |
4 | 8i9p:CC | 258 | 152 | 0.5474 | 0.2907 | 0.4934 | 5.21e-41 | |
5 | 8i9x:CC | 658 | 152 | 0.5474 | 0.1140 | 0.4934 | 3.29e-39 | 8i9r:CC, 8i9t:CC, 8i9v:CC, 8i9w:CC, 8i9y:CC, 8i9z:CC, 8ia0:CC, 8pv2:CC |
6 | 6cb1:s | 512 | 60 | 0.4380 | 0.1172 | 1.0000 | 5.60e-36 | 6c0f:s |
7 | 6cb1:s | 512 | 24 | 0.1752 | 0.0469 | 1.0000 | 8.86e-09 | 6c0f:s |
8 | 8fkp:SS | 235 | 144 | 0.4599 | 0.2681 | 0.4375 | 1.85e-30 | 8fkq:SS, 8fkr:SS, 8fks:SS |
9 | 8fky:SS | 628 | 153 | 0.4599 | 0.1003 | 0.4118 | 7.02e-28 | 8fkt:SS, 8fku:SS, 8fkv:SS, 8fkw:SS, 8fkx:SS |
10 | 8esq:m | 572 | 147 | 0.4526 | 0.1084 | 0.4218 | 2.16e-23 | 8esr:m, 8etg:m, 8eti:m, 8eug:m, 8eui:m |
11 | 8eth:m | 76 | 58 | 0.1971 | 0.3553 | 0.4655 | 2.31e-12 | 8eup:m, 8ev3:m |
12 | 8euy:m | 92 | 58 | 0.1971 | 0.2935 | 0.4655 | 2.96e-12 | |
13 | 3jb6:B | 498 | 65 | 0.1460 | 0.0402 | 0.3077 | 1.3 | 3jb7:B |
14 | 7v55:A | 781 | 37 | 0.1241 | 0.0218 | 0.4595 | 1.3 | |
15 | 2dns:A | 362 | 29 | 0.0803 | 0.0304 | 0.3793 | 2.9 | 2dns:B, 2dns:C, 2dns:D, 2dns:E, 2efu:A, 2efu:B, 2efu:C, 2efu:D, 2efx:A, 2efx:B, 2efx:C, 2efx:D, 2efx:E |
16 | 2efu:E | 342 | 29 | 0.0803 | 0.0322 | 0.3793 | 3.0 | 2efu:F, 2efx:F |
17 | 6ipz:Z | 63 | 49 | 0.0949 | 0.2063 | 0.2653 | 3.8 | 1a0n:B, 1azg:B, 4eik:A, 1fyn:A, 8kdx:A, 3ua7:A, 3ua7:D, 3ua7:C, 4znx:A, 4znx:D, 4znx:B, 4znx:C |
18 | 8eza:L | 3720 | 27 | 0.0803 | 0.0030 | 0.4074 | 8.5 | 8eza:C, 7lt3:C, 7lt3:L |
19 | 7ebp:A | 526 | 34 | 0.0803 | 0.0209 | 0.3235 | 8.9 | 7ebp:B, 7ebq:A |