BioLiP

>protein
PVYRLPPLPRLKVKKPIIRQEANKCLVLMSNLLQCWSSYGHMSPKCAGLVTELKSCTSESALGKSNINYHAARLYDRING
KPHD

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8om2:Z	92	90	1.0000	0.9130	0.9333	1.83e-56	8d8k:Z, 8d8l:Z, 5mrc:ZZ, 5mre:ZZ, 5mrf:ZZ, 8om3:Z, 8om4:Z
2	6yw5:11	88	78	0.3333	0.3182	0.3590	6.48e-12	6ywe:11, 6ywx:11, 6ywy:11
3	7pnw:2	117	65	0.2024	0.1453	0.2615	1.3
4	3jd5:m	118	69	0.2024	0.1441	0.2464	2.4	5aj3:m, 5aj4:Am, 6gaw:Am, 6gaz:Am, 6neq:m, 6nf8:m, 7nqh:Am, 7nql:Am, 7nsi:Am, 7nsj:Am, 8oin:Ac, 8oip:Ac, 6ydp:Am, 6ydw:Am
5	5ywr:B	87	26	0.0952	0.0920	0.3077	4.4
6	6z1p:BB	110	17	0.0833	0.0636	0.4118	6.9
7	6wot:A	4197	43	0.1786	0.0036	0.3488	9.0	6wot:B, 6wot:C, 6wot:D
8	7p84:C	408	29	0.1190	0.0245	0.3448	9.1	7p84:A, 7p8m:A, 7p8m:C
9	4k0b:A	404	29	0.1190	0.0248	0.3448	9.1	4k0b:B, 4l2z:A, 4l2z:B, 4l7i:A, 4l7i:B
10	7m6a:A	4306	43	0.1786	0.0035	0.3488	9.3	7m6a:G, 7m6a:B, 7m6a:I, 7m6l:A, 7m6l:G, 7m6l:B, 7m6l:I
11	7tzc:A	4404	43	0.1786	0.0034	0.3488	9.3	3rqr:A, 8sen:A, 8sen:B, 8sen:C, 8sen:D, 8seo:A, 8seo:B, 8seo:C, 8seo:D, 8sep:A, 8sep:B, 8sep:C, 8sep:D, 8seq:A, 8seq:B, 8seq:C, 8seq:D, 8ser:A, 8ser:B, 8ser:C, 8ser:D, 8ses:A, 8ses:B, 8ses:C, 8ses:D, 8set:A, 8set:B, 8set:C, 8set:D, 7tzc:B, 7tzc:G, 7tzc:I
12	8vk4:D	4379	43	0.1786	0.0034	0.3488	9.5	8vjj:A, 8vjj:D, 8vjj:B, 8vjj:C, 8vjk:A, 8vjk:B, 8vjk:C, 8vjk:D, 8vk3:A, 8vk3:D, 8vk3:B, 8vk3:C, 8vk4:A, 8vk4:B, 8vk4:C

[Back]