PVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCR
GQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADS
The query sequence (length=121) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ahr:K | 121 | 121 | 1.0000 | 1.0000 | 1.0000 | 9.62e-87 | 6ahu:K |
2 | 6agb:K | 128 | 70 | 0.1818 | 0.1719 | 0.3143 | 1.38e-04 | 6ah3:K |
3 | 6k0b:G | 120 | 88 | 0.2066 | 0.2083 | 0.2841 | 0.020 | 6k0a:G, 6k0a:H, 6k0b:H |
4 | 7jl0:A | 662 | 80 | 0.2066 | 0.0378 | 0.3125 | 0.025 | 7jl2:A, 7jl2:C, 7jl2:E |
5 | 4gl2:A | 617 | 60 | 0.1488 | 0.0292 | 0.3000 | 0.038 | 4gl2:B |
6 | 6tf9:UP1 | 569 | 64 | 0.1240 | 0.0264 | 0.2344 | 1.1 | |
7 | 2d0v:A | 597 | 14 | 0.0744 | 0.0151 | 0.6429 | 1.5 | 2d0v:D, 2d0v:I |
8 | 7bkq:A | 640 | 78 | 0.1653 | 0.0312 | 0.2564 | 1.5 | |
9 | 6h61:A | 660 | 78 | 0.1653 | 0.0303 | 0.2564 | 1.6 | 6g1s:A, 6g1x:A, 7nga:A |
10 | 5zns:A | 381 | 52 | 0.1240 | 0.0394 | 0.2885 | 2.1 | 5znt:A |
11 | 1w6s:C | 596 | 21 | 0.0744 | 0.0151 | 0.4286 | 2.2 | 1h4i:A, 1h4i:C, 1h4j:A, 1h4j:C, 1h4j:E, 1h4j:G, 1w6s:A |
12 | 7bkp:A | 689 | 76 | 0.1653 | 0.0290 | 0.2632 | 3.9 | 6g19:A, 6gjz:A, 6gkh:A, 6gkm:A, 6h66:A, 7nic:A, 7niq:B |
13 | 8gym:s1 | 689 | 67 | 0.1570 | 0.0276 | 0.2836 | 4.3 | 8b6f:AB, 8bqs:AB, 8gym:S1, 8gzu:s1, 8gzu:S1, 7tgh:S1 |
14 | 4aah:A | 571 | 21 | 0.0661 | 0.0140 | 0.3810 | 6.8 | 4aah:C, 2ad6:A, 2ad6:C, 2ad7:A, 2ad7:C, 2ad8:A, 2ad8:C, 1g72:A, 1g72:C |