PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHA
LLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTA
PPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRV
LVSFALP
The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3dtk:A | 247 | 247 | 1.0000 | 1.0000 | 1.0000 | 7.31e-179 | 3dti:A |
2 | 8slm:A | 248 | 246 | 0.8097 | 0.8065 | 0.8130 | 2.86e-125 | 8sln:A |
3 | 1g5c:A | 169 | 138 | 0.1498 | 0.2189 | 0.2681 | 0.022 | 1g5c:B, 1g5c:C, 1g5c:D, 1g5c:E, 1g5c:F |
4 | 7aor:aa | 1558 | 88 | 0.1215 | 0.0193 | 0.3409 | 0.10 | |
5 | 7t5t:A | 278 | 73 | 0.1012 | 0.0899 | 0.3425 | 0.30 | |
6 | 1b4p:A | 217 | 39 | 0.0607 | 0.0691 | 0.3846 | 0.89 | |
7 | 4tm7:A | 243 | 69 | 0.0810 | 0.0823 | 0.2899 | 2.0 | |
8 | 7x5h:R | 274 | 42 | 0.0648 | 0.0584 | 0.3810 | 5.0 | 7um4:A, 7um5:A, 7um6:A, 7um7:A |
9 | 7bi6:A | 829 | 158 | 0.1700 | 0.0507 | 0.2658 | 5.4 | 8a9i:A, 7bi9:A, 7z74:A, 7z75:A |
10 | 7bi2:A | 1021 | 158 | 0.1700 | 0.0411 | 0.2658 | 5.5 | |
11 | 2v0n:A | 459 | 85 | 0.0931 | 0.0501 | 0.2706 | 6.0 | 2v0n:B, 1w25:A, 1w25:B, 2wb4:A, 2wb4:B |
12 | 5x4z:N | 1074 | 25 | 0.0405 | 0.0093 | 0.4000 | 9.9 | 5x4z:B, 5x51:B, 5x51:N |
13 | 1w5f:A | 315 | 66 | 0.0810 | 0.0635 | 0.3030 | 10.0 | 1w5f:B |