BioLiP

>protein
PSTVQELDLAGITDSGLRADYIASSQLFRKIGRGRFLGRYMMHPAKRPYFDTFFSFVCYIDDLADDINLSVDVRARRLDE
WQRTYLAIAKQTDAALARALVHTLRTWDLPYLRVPEFVDGHRKALTTYEYADQEELDDFLETVTLLPAIWINQIFEPISE
DAEELCRHTITAFQLLDFIWDLREDLDLGRLYLPLDHLARFGLTRADLDRQIGSGYISDALRELIQFEIDIAREHMNAGR
SWPQTLHPTARIFMETDIQTHDSMFPEMIKDDYAFFKSPLDFVSGRMIPRTAKAIARARKANQQATRAGYRIRPPYR

The query sequence (length=317) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7vwt:A	326	328	0.9905	0.9632	0.9573	0.0	7vwt:B
2	7vws:B	328	328	0.7571	0.7317	0.7317	2.02e-178	7vws:A
3	8is7:A	275	121	0.1009	0.1164	0.2645	0.002	8is8:A, 8is9:A, 8isa:A
4	5iys:A	283	32	0.0410	0.0459	0.4062	0.35
5	1e3a:B	560	41	0.0568	0.0321	0.4390	3.5	1ai4:B, 1ai5:B, 1ai6:B, 1ai7:B, 1ajn:B, 1ajp:B, 1ajq:B, 1fxh:B, 1fxv:B, 1gk9:B, 1gkf:B, 1gm7:B, 1gm8:B, 1gm9:B, 1h2g:B, 1jx9:B, 1k5q:B, 1k5s:B, 1k7d:B, 1kec:B, 1pnk:B, 1pnl:B, 1pnm:B
6	6c8c:A	119	89	0.0694	0.1849	0.2472	5.1	6c8c:B, 4fjo:A, 4gk5:E, 2lsi:A, 2lsj:A, 2lsk:A, 2n1g:A
7	1fp1:D	340	69	0.0631	0.0588	0.2899	5.4	1fpq:A
8	4jxy:A	311	58	0.0662	0.0675	0.3621	5.8
9	6eki:A	222	91	0.0820	0.1171	0.2857	5.9	6eki:B, 6eki:C, 6eki:D, 6eki:E, 6eki:F
10	3u24:A	546	48	0.0473	0.0275	0.3125	6.0
11	8ro0:E	312	91	0.0599	0.0609	0.2088	7.3	8ro1:E
12	7nc5:A	239	95	0.0789	0.1046	0.2632	7.6	7nc5:B, 7nc5:C, 7nc5:D, 7nc5:E, 7nc5:F, 7nc6:A, 7nc6:B, 7nc6:C, 7nc6:D, 7nc6:E, 7nc6:F, 7ncu:A, 7ncu:B
13	2fyf:A	368	39	0.0473	0.0408	0.3846	9.7	2fyf:B, 3vom:A, 3vom:B

[Back]