PSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLA
ESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTFM
EAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSRKELLNFYAWQHRESKM
The query sequence (length=234) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7mq8:NI | 234 | 234 | 1.0000 | 1.0000 | 1.0000 | 8.08e-174 | 7mq9:NI, 7mqa:NI |
2 | 5ifm:C | 256 | 44 | 0.0641 | 0.0586 | 0.3409 | 0.15 | 5ifm:A |
3 | 2adc:A | 208 | 34 | 0.0556 | 0.0625 | 0.3824 | 1.4 | |
4 | 8xzi:R | 309 | 25 | 0.0470 | 0.0356 | 0.4400 | 2.0 | 7w0l:Q, 7w0l:R, 7w0m:R, 7w0n:R, 7w0n:Q, 7w0o:R, 7w0p:R, 8xzf:R, 8xzg:R, 8xzh:R, 8xzj:R |
5 | 7uj1:B | 270 | 37 | 0.0556 | 0.0481 | 0.3514 | 2.2 | 7pu5:B, 7pu5:D, 7pu5:H, 7pu5:J, 7pu5:L, 7sp0:B, 7uj1:A |
6 | 5vbl:B | 353 | 25 | 0.0470 | 0.0312 | 0.4400 | 2.3 | 6knm:B, 7sus:A |
7 | 6xyw:AQ | 366 | 128 | 0.1325 | 0.0847 | 0.2422 | 3.4 | |
8 | 7s7b:C | 79 | 77 | 0.1111 | 0.3291 | 0.3377 | 3.6 | 7s7b:G, 7s7c:C |
9 | 2q88:A | 257 | 109 | 0.1197 | 0.1089 | 0.2569 | 3.8 | 2q89:A |
10 | 5iky:A | 1048 | 70 | 0.0983 | 0.0219 | 0.3286 | 4.1 | 5ikz:A |
11 | 3ne8:A | 226 | 60 | 0.0812 | 0.0841 | 0.3167 | 7.0 | |
12 | 2z1q:B | 549 | 58 | 0.0726 | 0.0310 | 0.2931 | 7.6 | 2z1q:A |
13 | 7vsj:A | 160 | 31 | 0.0556 | 0.0813 | 0.4194 | 9.7 | 6fqr:A, 6gx6:A, 7yew:A, 7yew:C, 7yex:A |