Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
PSPEILALRWKDTSAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFLVKTKLHASMQDWLESVYAAAPTEEYE
RTVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDASLSAAQAAATCRYVADVTMTAVEMMSHAY

The query sequence (length=151) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6m9a:C 157 155 0.9735 0.9363 0.9484 4.76e-105 6i2z:A, 6i2z:B, 6m9a:A, 6m9a:B, 4uiq:A, 4uiq:B
2 4uii:A 132 149 0.2914 0.3333 0.2953 2.49e-15 4uii:B
3 4zvb:A 150 130 0.2649 0.2667 0.3077 1.03e-09 4zva:A, 4zva:B, 4zvb:B, 4zvb:C, 4zvb:D
4 2w31:A 152 77 0.1788 0.1776 0.3506 2.00e-07 2w31:B
5 5ohe:F 155 72 0.1457 0.1419 0.3056 0.17 5ohe:A, 5ohe:B, 5ohe:C, 5ohe:D, 5ohe:E, 5ohe:G, 5ohe:H, 5ohf:A, 5ohf:B, 5ohf:C, 5ohf:D, 5ohf:E, 5ohf:F, 5ohf:G, 5ohf:H, 6otd:A
6 3obz:A 290 25 0.0728 0.0379 0.4400 0.51
7 3t0c:A 737 107 0.1589 0.0326 0.2243 3.3
8 2xzl:A 756 50 0.1126 0.0225 0.3400 8.6
9 3b8a:X 470 26 0.0861 0.0277 0.5000 8.9

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218